Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5926
Gene name
LocationContig_3:56568..60244
Strand-
Gene length (bp)3676
Transcript length (bp)3609
Coding sequence length (bp)3609
Protein length (aa) 1203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 4.1E-07 100 280

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43027|RGA6_SCHPO Probable Rho-GTPase-activating protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga6 PE=1 SV=1 90 281 3.0E-12

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5926
MEDFDSGQQGNSGHGSEKRGWLHRLLRPSPNCEHGASQDIASPPCQLQVRHRRSVSDLANIIRSRREPPRILCIQ
NMVRLSGTSLLYLPPDYAPCSLILPTCLRATAQHLAQNAATRGLFRIPGSVRVVTALFDHYCYVEPGGDVIAATV
RCANLPLHISYAVHDVASTFKKLLSVLPGGILGSLALFDAFVAIHSHLNGEPEFPRTKQTKVRARLIALAIGTVQ
SQFRRELICAVMGLLSLIGRVAEVTPREDQDGRPLPTGDLMGYSALGIVFGPLLVGELLDQYAMGLATPTAGMLL
FPFSPRGFRDRRRTKPDTLQPGLPNVDKIFVANNIAEMLIANWRDVVRQMKALGAHHRKNGSVVHEHSGSLRPSI
SEPYAINLQQGVRATARKCNRSERQSSPEPDTPAMGSKGRRNKPLKNASSHRLLQKMSTQTLSPTREESLSDGGL
TDRRGVSWQDQDQVVDEPTAPAVAAACPNDHKHTQRSINEQLGDAICAATNPSLNEESMKEPPLRLLREKEAVAS
RPQIYLDRVPPRVSSKSRQGRDSSETTHTFMSHQVGNSTNLSPTPAPARPGKARERDEDNAPIKLDSHECSEDSA
ATFYSLCSDRLCRGVEATGSMGNENTQLDRPSSPRGRSRAKAPTRYIAMPGIDGLVQRGSAHEPRQRSETESSGR
AARGASRRSTSSAKTPRKTTDRQSEESQIAAAQSSPRRNSISSTPDRLYPLCQPRGNDRREQCHEPRKQTHGHER
SPTRELANSPSRGSSAQALSKRGSVKVMAALFDSQGSIHQRIATQSKNAGSNEDALIETPTAPPCRCVRQSQVEP
SWMAGVLDKSFASMSSGRERSHIGPRSRLEKADVRGTQSPGSLGTPVAGAIADINGESPQAEADRLACHLHARRS
TPTLRHPETSMGTCEKLRPVSNLGVALPDSGKLLIAQPSRPLSTPPSASPSGEGRARALRSLSSASDVPRISASV
LYSQVRSLQRHLSAKAEETAQLRRQIAAQEDSEVSTLSAQLNAARRDALMWKERAESAEKRIKMFEGFSARLRSM
RDAMSEVQQRPKDIHDAEDDSHLAPIRKSLSQNGSDVPGGRARRASRAERHVDFNESLGDEKDEASENKEHPGDS
FSRARRYLESHLTMTAAGNMNGVVSSQRRARSGTMGGDGAGSFQGDEGPDLMTVDARENIWAAAEELLWMMEDER
VS*
Coding >Hirsu2|5926
ATGGAGGACTTCGATTCCGGGCAGCAGGGCAATTCCGGCCACGGCTCTGAGAAGCGAGGATGGCTTCACAGACTC
CTCCGACCGAGCCCGAACTGTGAGCATGGAGCCTCCCAAGACATCGCGTCCCCCCCCTGTCAGCTTCAAGTACGG
CATAGACGAAGTGTCTCAGACCTGGCAAACATCATACGTTCCCGCCGCGAGCCTCCTCGGATCCTCTGCATCCAG
AACATGGTCCGGCTGAGTGGGACCAGCCTGCTCTACCTCCCGCCCGATTACGCGCCGTGCTCTCTGATCCTGCCG
ACGTGTCTTCGTGCTACTGCCCAGCACCTCGCCCAGAATGCTGCCACTCGCGGGCTGTTTCGAATTCCCGGGTCT
GTGCGAGTTGTGACGGCTCTGTTCGATCACTATTGCTACGTGGAGCCTGGCGGCGATGTCATCGCCGCCACGGTT
CGCTGCGCCAACCTGCCGCTGCACATCTCGTACGCAGTTCACGATGTCGCGTCGACCTTCAAAAAGCTGTTGTCT
GTTTTGCCCGGAGGCATCCTCGGATCTCTTGCCCTCTTTGACGCCTTCGTGGCCATCCATTCACACCTCAATGGA
GAACCCGAGTTTCCGCGGACCAAGCAGACCAAGGTACGCGCGAGACTCATTGCCTTGGCCATCGGCACCGTCCAG
TCCCAGTTCCGTCGCGAGCTGATATGCGCTGTCATGGGACTTCTGAGCTTAATCGGCCGAGTTGCCGAGGTGACG
CCACGGGAGGACCAGGACGGCCGGCCATTGCCGACCGGAGACTTGATGGGCTACAGTGCTTTGGGAATTGTCTTC
GGACCCCTCCTCGTGGGGGAACTGTTGGATCAGTATGCGATGGGGCTGGCCACACCGACTGCGGGAATGCTTCTG
TTTCCTTTCAGCCCTCGAGGGTTTCGAGACCGGCGCAGGACTAAGCCGGACACTCTTCAGCCCGGGCTTCCAAAT
GTGGACAAAATTTTCGTGGCGAACAACATTGCCGAGATGCTCATAGCCAACTGGCGCGACGTCGTGCGCCAGATG
AAAGCACTAGGTGCTCATCATCGCAAAAATGGATCTGTGGTACACGAACACAGCGGCTCCCTACGTCCATCCATT
TCAGAGCCCTATGCCATCAATTTGCAGCAAGGCGTGAGAGCCACTGCGAGGAAATGCAACCGATCCGAGCGCCAG
AGCAGCCCTGAGCCGGACACGCCAGCTATGGGTTCGAAGGGACGGCGGAACAAGCCTTTGAAGAACGCCTCCTCT
CACAGATTGCTGCAGAAGATGAGCACTCAGACTTTGAGCCCGACCAGGGAAGAAAGTTTGTCGGATGGGGGATTG
ACAGACCGCCGAGGTGTTTCGTGGCAAGACCAAGACCAGGTCGTTGACGAGCCGACTGCACCAGCTGTGGCAGCC
GCCTGTCCCAACGACCATAAGCACACACAAAGATCGATCAATGAGCAGCTAGGCGATGCGATTTGTGCAGCGACA
AATCCGAGCTTGAACGAGGAGAGCATGAAGGAGCCACCGTTGCGGTTGTTAAGGGAGAAGGAGGCAGTTGCAAGC
CGCCCACAGATATACCTCGACAGGGTCCCCCCACGAGTGTCGTCCAAATCAAGACAGGGTCGTGACAGCTCAGAG
ACGACGCACACGTTCATGTCTCATCAAGTTGGAAACTCGACTAATCTATCTCCGACTCCTGCTCCGGCGCGGCCA
GGAAAGGCCCGCGAGAGGGATGAAGACAACGCTCCAATCAAATTGGACTCGCACGAATGCTCTGAAGACTCGGCG
GCCACCTTTTACTCCTTGTGCTCCGACAGGCTTTGCCGTGGAGTTGAAGCCACTGGCTCGATGGGGAACGAAAAT
ACCCAGCTTGATCGTCCGTCCTCGCCGCGCGGACGAAGCCGAGCAAAAGCTCCAACCCGGTACATAGCCATGCCT
GGGATAGACGGCTTGGTGCAACGTGGTTCGGCGCATGAGCCAAGGCAACGATCTGAGACCGAAAGTTCAGGTAGA
GCTGCCAGAGGGGCAAGCAGACGCTCTACTTCAAGCGCAAAAACGCCGAGGAAAACCACTGATCGACAGAGCGAA
GAATCTCAAATTGCGGCGGCACAAAGTTCACCTCGGAGGAACTCGATCAGCAGTACACCCGACCGTCTGTATCCG
CTCTGTCAACCGCGAGGGAATGATCGTCGGGAGCAGTGCCACGAGCCTCGCAAACAGACGCATGGACATGAGAGG
AGCCCGACGAGGGAATTGGCGAACTCACCCTCACGAGGCAGCAGTGCCCAGGCCCTCAGTAAACGGGGGTCTGTC
AAGGTCATGGCTGCCTTGTTTGACAGCCAGGGCTCGATCCATCAGCGAATAGCAACACAGAGCAAAAATGCGGGC
AGCAACGAGGACGCGTTGATTGAAACCCCAACTGCTCCACCCTGCAGATGTGTTCGTCAGTCTCAAGTGGAGCCA
TCGTGGATGGCCGGCGTCTTGGATAAGTCATTTGCCTCCATGTCTTCGGGCAGAGAACGTTCACACATTGGCCCC
AGATCGAGGCTGGAAAAGGCTGATGTGAGGGGCACGCAAAGCCCCGGCAGTTTGGGGACTCCTGTCGCCGGAGCC
ATAGCGGACATAAATGGTGAATCGCCACAGGCGGAAGCGGACAGATTGGCTTGTCATCTCCATGCCAGAAGATCG
ACGCCAACACTTCGGCATCCCGAGACGAGTATGGGGACTTGTGAAAAGCTGAGGCCTGTTTCGAATCTTGGTGTT
GCTCTGCCGGACAGTGGAAAACTCTTGATTGCGCAGCCGTCTCGACCACTTTCAACGCCTCCTTCTGCCAGCCCC
TCGGGCGAGGGGAGGGCGCGAGCTCTTCGTTCTCTTTCTTCGGCCAGCGACGTTCCTCGGATCAGCGCCTCCGTA
CTCTATTCCCAGGTCCGGAGCCTTCAGCGGCACTTGAGCGCCAAGGCAGAAGAGACGGCACAATTACGAAGACAA
ATCGCTGCGCAGGAGGATTCTGAAGTCAGTACCCTGAGTGCACAATTAAATGCTGCCAGGAGGGATGCGCTGATG
TGGAAAGAGAGAGCCGAGTCGGCGGAGAAAAGGATCAAGATGTTTGAAGGGTTTTCAGCACGTCTCCGAAGCATG
AGAGACGCGATGTCCGAGGTGCAGCAGCGCCCCAAAGACATTCATGACGCTGAAGACGACTCGCACCTCGCACCG
ATACGCAAGAGTCTGTCACAAAATGGAAGCGATGTTCCTGGGGGACGGGCGCGCAGAGCTTCAAGGGCCGAAAGA
CACGTTGACTTCAACGAGAGCCTCGGTGACGAGAAAGACGAGGCTTCCGAAAACAAAGAGCATCCGGGAGATTCC
TTCTCCAGGGCGCGAAGATATCTCGAGAGTCACCTGACGATGACCGCTGCAGGCAACATGAACGGGGTGGTCAGT
AGCCAACGTCGGGCACGGAGTGGGACAATGGGCGGGGACGGTGCTGGAAGCTTCCAAGGGGACGAAGGTCCTGAC
TTGATGACAGTGGATGCCAGGGAGAACATTTGGGCTGCGGCAGAGGAGCTACTATGGATGATGGAAGACGAGAGA
GTGTCGTAA
Transcript >Hirsu2|5926
ATGGAGGACTTCGATTCCGGGCAGCAGGGCAATTCCGGCCACGGCTCTGAGAAGCGAGGATGGCTTCACAGACTC
CTCCGACCGAGCCCGAACTGTGAGCATGGAGCCTCCCAAGACATCGCGTCCCCCCCCTGTCAGCTTCAAGTACGG
CATAGACGAAGTGTCTCAGACCTGGCAAACATCATACGTTCCCGCCGCGAGCCTCCTCGGATCCTCTGCATCCAG
AACATGGTCCGGCTGAGTGGGACCAGCCTGCTCTACCTCCCGCCCGATTACGCGCCGTGCTCTCTGATCCTGCCG
ACGTGTCTTCGTGCTACTGCCCAGCACCTCGCCCAGAATGCTGCCACTCGCGGGCTGTTTCGAATTCCCGGGTCT
GTGCGAGTTGTGACGGCTCTGTTCGATCACTATTGCTACGTGGAGCCTGGCGGCGATGTCATCGCCGCCACGGTT
CGCTGCGCCAACCTGCCGCTGCACATCTCGTACGCAGTTCACGATGTCGCGTCGACCTTCAAAAAGCTGTTGTCT
GTTTTGCCCGGAGGCATCCTCGGATCTCTTGCCCTCTTTGACGCCTTCGTGGCCATCCATTCACACCTCAATGGA
GAACCCGAGTTTCCGCGGACCAAGCAGACCAAGGTACGCGCGAGACTCATTGCCTTGGCCATCGGCACCGTCCAG
TCCCAGTTCCGTCGCGAGCTGATATGCGCTGTCATGGGACTTCTGAGCTTAATCGGCCGAGTTGCCGAGGTGACG
CCACGGGAGGACCAGGACGGCCGGCCATTGCCGACCGGAGACTTGATGGGCTACAGTGCTTTGGGAATTGTCTTC
GGACCCCTCCTCGTGGGGGAACTGTTGGATCAGTATGCGATGGGGCTGGCCACACCGACTGCGGGAATGCTTCTG
TTTCCTTTCAGCCCTCGAGGGTTTCGAGACCGGCGCAGGACTAAGCCGGACACTCTTCAGCCCGGGCTTCCAAAT
GTGGACAAAATTTTCGTGGCGAACAACATTGCCGAGATGCTCATAGCCAACTGGCGCGACGTCGTGCGCCAGATG
AAAGCACTAGGTGCTCATCATCGCAAAAATGGATCTGTGGTACACGAACACAGCGGCTCCCTACGTCCATCCATT
TCAGAGCCCTATGCCATCAATTTGCAGCAAGGCGTGAGAGCCACTGCGAGGAAATGCAACCGATCCGAGCGCCAG
AGCAGCCCTGAGCCGGACACGCCAGCTATGGGTTCGAAGGGACGGCGGAACAAGCCTTTGAAGAACGCCTCCTCT
CACAGATTGCTGCAGAAGATGAGCACTCAGACTTTGAGCCCGACCAGGGAAGAAAGTTTGTCGGATGGGGGATTG
ACAGACCGCCGAGGTGTTTCGTGGCAAGACCAAGACCAGGTCGTTGACGAGCCGACTGCACCAGCTGTGGCAGCC
GCCTGTCCCAACGACCATAAGCACACACAAAGATCGATCAATGAGCAGCTAGGCGATGCGATTTGTGCAGCGACA
AATCCGAGCTTGAACGAGGAGAGCATGAAGGAGCCACCGTTGCGGTTGTTAAGGGAGAAGGAGGCAGTTGCAAGC
CGCCCACAGATATACCTCGACAGGGTCCCCCCACGAGTGTCGTCCAAATCAAGACAGGGTCGTGACAGCTCAGAG
ACGACGCACACGTTCATGTCTCATCAAGTTGGAAACTCGACTAATCTATCTCCGACTCCTGCTCCGGCGCGGCCA
GGAAAGGCCCGCGAGAGGGATGAAGACAACGCTCCAATCAAATTGGACTCGCACGAATGCTCTGAAGACTCGGCG
GCCACCTTTTACTCCTTGTGCTCCGACAGGCTTTGCCGTGGAGTTGAAGCCACTGGCTCGATGGGGAACGAAAAT
ACCCAGCTTGATCGTCCGTCCTCGCCGCGCGGACGAAGCCGAGCAAAAGCTCCAACCCGGTACATAGCCATGCCT
GGGATAGACGGCTTGGTGCAACGTGGTTCGGCGCATGAGCCAAGGCAACGATCTGAGACCGAAAGTTCAGGTAGA
GCTGCCAGAGGGGCAAGCAGACGCTCTACTTCAAGCGCAAAAACGCCGAGGAAAACCACTGATCGACAGAGCGAA
GAATCTCAAATTGCGGCGGCACAAAGTTCACCTCGGAGGAACTCGATCAGCAGTACACCCGACCGTCTGTATCCG
CTCTGTCAACCGCGAGGGAATGATCGTCGGGAGCAGTGCCACGAGCCTCGCAAACAGACGCATGGACATGAGAGG
AGCCCGACGAGGGAATTGGCGAACTCACCCTCACGAGGCAGCAGTGCCCAGGCCCTCAGTAAACGGGGGTCTGTC
AAGGTCATGGCTGCCTTGTTTGACAGCCAGGGCTCGATCCATCAGCGAATAGCAACACAGAGCAAAAATGCGGGC
AGCAACGAGGACGCGTTGATTGAAACCCCAACTGCTCCACCCTGCAGATGTGTTCGTCAGTCTCAAGTGGAGCCA
TCGTGGATGGCCGGCGTCTTGGATAAGTCATTTGCCTCCATGTCTTCGGGCAGAGAACGTTCACACATTGGCCCC
AGATCGAGGCTGGAAAAGGCTGATGTGAGGGGCACGCAAAGCCCCGGCAGTTTGGGGACTCCTGTCGCCGGAGCC
ATAGCGGACATAAATGGTGAATCGCCACAGGCGGAAGCGGACAGATTGGCTTGTCATCTCCATGCCAGAAGATCG
ACGCCAACACTTCGGCATCCCGAGACGAGTATGGGGACTTGTGAAAAGCTGAGGCCTGTTTCGAATCTTGGTGTT
GCTCTGCCGGACAGTGGAAAACTCTTGATTGCGCAGCCGTCTCGACCACTTTCAACGCCTCCTTCTGCCAGCCCC
TCGGGCGAGGGGAGGGCGCGAGCTCTTCGTTCTCTTTCTTCGGCCAGCGACGTTCCTCGGATCAGCGCCTCCGTA
CTCTATTCCCAGGTCCGGAGCCTTCAGCGGCACTTGAGCGCCAAGGCAGAAGAGACGGCACAATTACGAAGACAA
ATCGCTGCGCAGGAGGATTCTGAAGTCAGTACCCTGAGTGCACAATTAAATGCTGCCAGGAGGGATGCGCTGATG
TGGAAAGAGAGAGCCGAGTCGGCGGAGAAAAGGATCAAGATGTTTGAAGGGTTTTCAGCACGTCTCCGAAGCATG
AGAGACGCGATGTCCGAGGTGCAGCAGCGCCCCAAAGACATTCATGACGCTGAAGACGACTCGCACCTCGCACCG
ATACGCAAGAGTCTGTCACAAAATGGAAGCGATGTTCCTGGGGGACGGGCGCGCAGAGCTTCAAGGGCCGAAAGA
CACGTTGACTTCAACGAGAGCCTCGGTGACGAGAAAGACGAGGCTTCCGAAAACAAAGAGCATCCGGGAGATTCC
TTCTCCAGGGCGCGAAGATATCTCGAGAGTCACCTGACGATGACCGCTGCAGGCAACATGAACGGGGTGGTCAGT
AGCCAACGTCGGGCACGGAGTGGGACAATGGGCGGGGACGGTGCTGGAAGCTTCCAAGGGGACGAAGGTCCTGAC
TTGATGACAGTGGATGCCAGGGAGAACATTTGGGCTGCGGCAGAGGAGCTACTATGGATGATGGAAGACGAGAGA
GTGTCGTAA
Gene >Hirsu2|5926
ATGGAGGACTTCGATTCCGGGCAGCAGGCAAGCCCCCTCCTACGGCATCAATTACCGCGGGCACGGCCTTCGGCA
TGCTGACAGAATTTGCCAGGGCAATTCCGGCCACGGCTCTGAGAAGCGAGGATGGCTTCACAGACTCCTCCGACC
GAGCCCGAACTGTGAGCATGGAGCCTCCCAAGACATCGCGTCCCCCCCCTGTCAGCTTCAAGTACGGCATAGACG
AAGTGTCTCAGACCTGGCAAACATCATACGTTCCCGCCGCGAGCCTCCTCGGATCCTCTGCATCCAGAACATGGT
CCGGCTGAGTGGGACCAGCCTGCTCTACCTCCCGCCCGATTACGCGCCGTGCTCTCTGATCCTGCCGACGTGTCT
TCGTGCTACTGCCCAGCACCTCGCCCAGAATGCTGCCACTCGCGGGCTGTTTCGAATTCCCGGGTCTGTGCGAGT
TGTGACGGCTCTGTTCGATCACTATTGCTACGTGGAGCCTGGCGGCGATGTCATCGCCGCCACGGTTCGCTGCGC
CAACCTGCCGCTGCACATCTCGTACGCAGTTCACGATGTCGCGTCGACCTTCAAAAAGCTGTTGTCTGTTTTGCC
CGGAGGCATCCTCGGATCTCTTGCCCTCTTTGACGCCTTCGTGGCCATCCATTCACACCTCAATGGAGAACCCGA
GTTTCCGCGGACCAAGCAGACCAAGGTACGCGCGAGACTCATTGCCTTGGCCATCGGCACCGTCCAGTCCCAGTT
CCGTCGCGAGCTGATATGCGCTGTCATGGGACTTCTGAGCTTAATCGGCCGAGTTGCCGAGGTGACGCCACGGGA
GGACCAGGACGGCCGGCCATTGCCGACCGGAGACTTGATGGGCTACAGTGCTTTGGGAATTGTCTTCGGACCCCT
CCTCGTGGGGGAACTGTTGGATCAGTATGCGATGGGGCTGGCCACACCGACTGCGGGAATGCTTCTGTTTCCTTT
CAGCCCTCGAGGGTTTCGAGACCGGCGCAGGACTAAGCCGGACACTCTTCAGCCCGGGCTTCCAAATGTGGACAA
AATTTTCGTGGCGAACAACATTGCCGAGATGCTCATAGCCAACTGGCGCGACGTCGTGCGCCAGATGAAAGCACT
AGGTGCTCATCATCGCAAAAATGGATCTGTGGTACACGAACACAGCGGCTCCCTACGTCCATCCATTTCAGAGCC
CTATGCCATCAATTTGCAGCAAGGCGTGAGAGCCACTGCGAGGAAATGCAACCGATCCGAGCGCCAGAGCAGCCC
TGAGCCGGACACGCCAGCTATGGGTTCGAAGGGACGGCGGAACAAGCCTTTGAAGAACGCCTCCTCTCACAGATT
GCTGCAGAAGATGAGCACTCAGACTTTGAGCCCGACCAGGGAAGAAAGTTTGTCGGATGGGGGATTGACAGACCG
CCGAGGTGTTTCGTGGCAAGACCAAGACCAGGTCGTTGACGAGCCGACTGCACCAGCTGTGGCAGCCGCCTGTCC
CAACGACCATAAGCACACACAAAGATCGATCAATGAGCAGCTAGGCGATGCGATTTGTGCAGCGACAAATCCGAG
CTTGAACGAGGAGAGCATGAAGGAGCCACCGTTGCGGTTGTTAAGGGAGAAGGAGGCAGTTGCAAGCCGCCCACA
GATATACCTCGACAGGGTCCCCCCACGAGTGTCGTCCAAATCAAGACAGGGTCGTGACAGCTCAGAGACGACGCA
CACGTTCATGTCTCATCAAGTTGGAAACTCGACTAATCTATCTCCGACTCCTGCTCCGGCGCGGCCAGGAAAGGC
CCGCGAGAGGGATGAAGACAACGCTCCAATCAAATTGGACTCGCACGAATGCTCTGAAGACTCGGCGGCCACCTT
TTACTCCTTGTGCTCCGACAGGCTTTGCCGTGGAGTTGAAGCCACTGGCTCGATGGGGAACGAAAATACCCAGCT
TGATCGTCCGTCCTCGCCGCGCGGACGAAGCCGAGCAAAAGCTCCAACCCGGTACATAGCCATGCCTGGGATAGA
CGGCTTGGTGCAACGTGGTTCGGCGCATGAGCCAAGGCAACGATCTGAGACCGAAAGTTCAGGTAGAGCTGCCAG
AGGGGCAAGCAGACGCTCTACTTCAAGCGCAAAAACGCCGAGGAAAACCACTGATCGACAGAGCGAAGAATCTCA
AATTGCGGCGGCACAAAGTTCACCTCGGAGGAACTCGATCAGCAGTACACCCGACCGTCTGTATCCGCTCTGTCA
ACCGCGAGGGAATGATCGTCGGGAGCAGTGCCACGAGCCTCGCAAACAGACGCATGGACATGAGAGGAGCCCGAC
GAGGGAATTGGCGAACTCACCCTCACGAGGCAGCAGTGCCCAGGCCCTCAGTAAACGGGGGTCTGTCAAGGTCAT
GGCTGCCTTGTTTGACAGCCAGGGCTCGATCCATCAGCGAATAGCAACACAGAGCAAAAATGCGGGCAGCAACGA
GGACGCGTTGATTGAAACCCCAACTGCTCCACCCTGCAGATGTGTTCGTCAGTCTCAAGTGGAGCCATCGTGGAT
GGCCGGCGTCTTGGATAAGTCATTTGCCTCCATGTCTTCGGGCAGAGAACGTTCACACATTGGCCCCAGATCGAG
GCTGGAAAAGGCTGATGTGAGGGGCACGCAAAGCCCCGGCAGTTTGGGGACTCCTGTCGCCGGAGCCATAGCGGA
CATAAATGGTGAATCGCCACAGGCGGAAGCGGACAGATTGGCTTGTCATCTCCATGCCAGAAGATCGACGCCAAC
ACTTCGGCATCCCGAGACGAGTATGGGGACTTGTGAAAAGCTGAGGCCTGTTTCGAATCTTGGTGTTGCTCTGCC
GGACAGTGGAAAACTCTTGATTGCGCAGCCGTCTCGACCACTTTCAACGCCTCCTTCTGCCAGCCCCTCGGGCGA
GGGGAGGGCGCGAGCTCTTCGTTCTCTTTCTTCGGCCAGCGACGTTCCTCGGATCAGCGCCTCCGTACTCTATTC
CCAGGTCCGGAGCCTTCAGCGGCACTTGAGCGCCAAGGCAGAAGAGACGGCACAATTACGAAGACAAATCGCTGC
GCAGGAGGATTCTGAAGTCAGTACCCTGAGTGCACAATTAAATGCTGCCAGGAGGGATGCGCTGATGTGGAAAGA
GAGAGCCGAGTCGGCGGAGAAAAGGATCAAGATGTTTGAAGGGTTTTCAGCACGTCTCCGAAGCATGAGAGACGC
GATGTCCGAGGTGCAGCAGCGCCCCAAAGACATTCATGACGCTGAAGACGACTCGCACCTCGCACCGATACGCAA
GAGTCTGTCACAAAATGGAAGCGATGTTCCTGGGGGACGGGCGCGCAGAGCTTCAAGGGCCGAAAGACACGTTGA
CTTCAACGAGAGCCTCGGTGACGAGAAAGACGAGGCTTCCGAAAACAAAGAGCATCCGGGAGATTCCTTCTCCAG
GGCGCGAAGATATCTCGAGAGTCACCTGACGATGACCGCTGCAGGCAACATGAACGGGGTGGTCAGTAGCCAACG
TCGGGCACGGAGTGGGACAATGGGCGGGGACGGTGCTGGAAGCTTCCAAGGGGACGAAGGTCCTGACTTGATGAC
AGTGGATGCCAGGGAGAACATTTGGGCTGCGGCAGAGGAGCTACTATGGATGATGGAAGACGAGAGAGTGTCGTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail