Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5925
Gene name
LocationContig_3:49319..50723
Strand-
Gene length (bp)1404
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.9E-07 181 421
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.3E-06 155 320
PF03583 LIP Secretory lipase 1.0E-06 181 438

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004806 triglyceride lipase activity Yes
GO:0016042 lipid catabolic process Yes
GO:1901575 organic substance catabolic process No
GO:0006629 lipid metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0016298 lipase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0009056 catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5925
MRRVLAFSAVAAAGFASAQQAANFNVSAEDARAHMCGDACQANIKRQNQLDLMAVGANFDYGFYATALNFTSSKP
GDVLKLEPLDPTQYSFKAGTSVWRLQYTSVDLDGQPVPVTGFIAFPYTTPPGDDDVAYDDGSEEQGTEPKPNRKF
RLAAFAHGTIGVFPGCAPSNGPSLYDYDSWQPLVARGYAVVATDYAGLGNNYTMHKYCSFPAHAADVYYSVLAAR
SLFGAVLTPEWISIGHSQGGGTAWKLAESDFVRTDTAYLGTVALAPATYIIDMLLKRMDGVDHPNYLPYLTVGVE
AANPQYHETLLSETLRRRIAMAKEAQLCTMAFMGLTADLRGNAKAIVSMEGVKRDMSTLLAWQNSTAPAMGGRSE
APMLVVQGLNDTTVLPRTTIQAVESSCASGSEIHLSLYPGLEHSPLLQASEAEWMGWIDDLFAAGRLDSIGECSS
NTKRVFNEDHVKLPGEE*
Coding >Hirsu2|5925
ATGCGTCGAGTGCTTGCATTCAGCGCCGTTGCCGCCGCCGGCTTCGCTTCGGCACAACAGGCCGCCAACTTCAAC
GTGTCGGCGGAGGATGCGCGTGCTCATATGTGCGGCGATGCATGCCAGGCAAACATCAAGCGGCAAAACCAGTTG
GATCTGATGGCTGTTGGAGCCAATTTCGACTACGGATTCTACGCAACGGCACTCAACTTCACGAGCAGCAAGCCC
GGAGACGTGCTCAAGCTGGAGCCGCTCGATCCAACACAGTACAGCTTCAAGGCCGGCACAAGTGTCTGGCGCCTA
CAATATACGTCGGTCGATCTCGACGGACAGCCAGTGCCGGTGACGGGCTTCATCGCCTTCCCCTACACCACGCCT
CCCGGGGACGACGACGTGGCCTACGACGATGGCTCCGAAGAGCAGGGCACGGAGCCGAAGCCGAACAGGAAGTTC
CGCCTCGCCGCCTTCGCACATGGAACCATCGGCGTCTTCCCCGGCTGCGCTCCGTCCAACGGCCCCAGCTTGTAT
GACTACGACAGTTGGCAGCCGCTCGTAGCGCGCGGGTACGCCGTCGTCGCCACCGACTACGCAGGCCTCGGCAAC
AATTACACGATGCACAAGTACTGCAGCTTCCCGGCCCACGCGGCCGACGTCTATTACTCGGTGCTCGCGGCCCGC
AGCCTCTTCGGCGCCGTGCTGACGCCGGAGTGGATCAGCATCGGGCACTCGCAGGGCGGCGGCACGGCCTGGAAG
CTGGCCGAGAGCGACTTCGTGCGCACTGACACGGCGTATCTGGGCACCGTGGCGCTGGCGCCGGCCACCTACATC
ATCGACATGCTGCTCAAGCGCATGGACGGCGTCGACCACCCCAATTACCTCCCCTACCTGACCGTGGGCGTGGAA
GCGGCCAACCCGCAGTACCACGAGACGCTGCTGTCCGAAACGCTCCGCCGGCGCATTGCGATGGCCAAGGAGGCC
CAGCTGTGTACGATGGCCTTTATGGGGCTCACCGCCGACCTCAGGGGCAATGCCAAGGCAATTGTATCCATGGAG
GGCGTCAAGCGTGACATGTCGACTCTGCTGGCCTGGCAGAATTCAACGGCGCCGGCTATGGGCGGCCGCTCGGAG
GCCCCGATGCTTGTCGTCCAGGGGCTCAACGACACGACCGTCCTGCCCAGGACGACGATTCAAGCCGTCGAGAGC
AGCTGCGCGAGTGGCAGCGAGATCCACCTCAGCCTTTACCCGGGCCTTGAGCACTCGCCGCTGCTGCAGGCCTCC
GAGGCCGAGTGGATGGGCTGGATCGACGACCTCTTCGCCGCCGGGAGGCTGGACAGCATCGGAGAATGCTCGAGC
AATACGAAGAGAGTCTTCAACGAGGACCATGTCAAGCTGCCGGGCGAGGAGTAA
Transcript >Hirsu2|5925
ATGCGTCGAGTGCTTGCATTCAGCGCCGTTGCCGCCGCCGGCTTCGCTTCGGCACAACAGGCCGCCAACTTCAAC
GTGTCGGCGGAGGATGCGCGTGCTCATATGTGCGGCGATGCATGCCAGGCAAACATCAAGCGGCAAAACCAGTTG
GATCTGATGGCTGTTGGAGCCAATTTCGACTACGGATTCTACGCAACGGCACTCAACTTCACGAGCAGCAAGCCC
GGAGACGTGCTCAAGCTGGAGCCGCTCGATCCAACACAGTACAGCTTCAAGGCCGGCACAAGTGTCTGGCGCCTA
CAATATACGTCGGTCGATCTCGACGGACAGCCAGTGCCGGTGACGGGCTTCATCGCCTTCCCCTACACCACGCCT
CCCGGGGACGACGACGTGGCCTACGACGATGGCTCCGAAGAGCAGGGCACGGAGCCGAAGCCGAACAGGAAGTTC
CGCCTCGCCGCCTTCGCACATGGAACCATCGGCGTCTTCCCCGGCTGCGCTCCGTCCAACGGCCCCAGCTTGTAT
GACTACGACAGTTGGCAGCCGCTCGTAGCGCGCGGGTACGCCGTCGTCGCCACCGACTACGCAGGCCTCGGCAAC
AATTACACGATGCACAAGTACTGCAGCTTCCCGGCCCACGCGGCCGACGTCTATTACTCGGTGCTCGCGGCCCGC
AGCCTCTTCGGCGCCGTGCTGACGCCGGAGTGGATCAGCATCGGGCACTCGCAGGGCGGCGGCACGGCCTGGAAG
CTGGCCGAGAGCGACTTCGTGCGCACTGACACGGCGTATCTGGGCACCGTGGCGCTGGCGCCGGCCACCTACATC
ATCGACATGCTGCTCAAGCGCATGGACGGCGTCGACCACCCCAATTACCTCCCCTACCTGACCGTGGGCGTGGAA
GCGGCCAACCCGCAGTACCACGAGACGCTGCTGTCCGAAACGCTCCGCCGGCGCATTGCGATGGCCAAGGAGGCC
CAGCTGTGTACGATGGCCTTTATGGGGCTCACCGCCGACCTCAGGGGCAATGCCAAGGCAATTGTATCCATGGAG
GGCGTCAAGCGTGACATGTCGACTCTGCTGGCCTGGCAGAATTCAACGGCGCCGGCTATGGGCGGCCGCTCGGAG
GCCCCGATGCTTGTCGTCCAGGGGCTCAACGACACGACCGTCCTGCCCAGGACGACGATTCAAGCCGTCGAGAGC
AGCTGCGCGAGTGGCAGCGAGATCCACCTCAGCCTTTACCCGGGCCTTGAGCACTCGCCGCTGCTGCAGGCCTCC
GAGGCCGAGTGGATGGGCTGGATCGACGACCTCTTCGCCGCCGGGAGGCTGGACAGCATCGGAGAATGCTCGAGC
AATACGAAGAGAGTCTTCAACGAGGACCATGTCAAGCTGCCGGGCGAGGAGTAA
Gene >Hirsu2|5925
ATGCGTCGAGTGCTTGCATTCAGCGCCGTTGCCGCCGCCGGCTTCGCTTCGGCACAACAGGCCGCCAACTTCAAC
GTGTCGGCGGAGGATGCGCGTGCTCATATGTGCGGCGATGCATGCCAGGCAAACATCAAGCGGCAAAACCAGTTG
GATCTGATGGCTGTTGGAGCCAATTTCGACTACGGATTCTACGCAACGGCACTCAACTTCACGAGCAGCAAGCCC
GGAGACGTGCTCAAGCTGGAGCCGCTCGATCCAACACAGTACAGCTTCAAGGCCGGCACAAGTGTCTGGCGCCTA
CAATATACGTCGGTCGATCTCGACGGACAGCCAGTGCCGGTGACGGGCTTCATCGCCTTCCCCTACACCACGCCT
CCCGGGGACGACGACGTGGCCTACGACGATGGCTCCGAAGAGCAGGGCACGGAGCCGAAGCCGAACAGGAAGTTC
CGCCTCGCCGCCTTCGCACATGGAACCATCGGCGTCTTCCCCGGCTGCGCTCCGTCCAACGGCCCCAGCTTGTAT
GACTACGACAGTTGGCAGCCGCTCGTAGCGCGCGGGTACGCCGTCGTCGCCACCGACTACGCAGGCCTCGGCAAC
AATTACACGATGCACAAGTACTGCAGCTTCCCGGCCCACGCGGCCGACGTCTATTACTCGGTGCTCGCGGCCCGC
AGCCTCTTCGGCGCCGTGCTGACGCCGGAGTGGATCAGCATCGGGCACTCGCAGGGCGGCGGCACGGCCTGGAAG
CTGGCCGAGAGCGACTTCGTGCGCACTGACACGGCGTATCTGGGCACCGTGGCGCTGGCGCCGGCCACCTACATC
ATCGACATGCTGCTCAAGCGCATGGACGGCGTCGACCACCCCAATTACCTCCCCTACCTGACCGTGGGCGTGGAA
GCGGCCAACCCGCAGTACCACGAGACGCTGCTGTCCGAAACGCTCCGCCGGCGCATTGCGATGGCCAAGGAGGCC
CAGCTGTGTACGATGGCCTTTATGGGGCTCACCGCCGACCTCAGGGGCAATGCCAAGGCAATTGTATCCATGGAG
GGCGTCAAGCGTGACATGTCGACTCTGCTGGCCTGGCAGAATTCAACGGCGCCGGCTATGGGCGGCCGCTCGGAG
GCCCCGATGCTTGTCGTCCAGGGGCTCAACGACACGACCGTCCTGCCCAGGACGACGATTCAAGCCGTCGAGAGC
AGCTGCGCGAGTGGCAGCGAGATCCACCTCAGCCTTTACCCGGGCCTTGAGCACTCGCCGCTGCTGCAGGCCTCC
GAGGCCGAGTGGATGGGCTGGATCGACGACCTCTTCGCCGCCGGGAGGCTGGACAGCATCGGAGAATGCTCGAGC
AATACGAAGAGAGTCTTCAACGAGGACCATGTCAAGCTGCCGGGCGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail