Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5913
Gene name
LocationContig_3:16981..20772
Strand+
Gene length (bp)3791
Transcript length (bp)3276
Coding sequence length (bp)3276
Protein length (aa) 1092

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02233 PNTB NAD(P) transhydrogenase beta subunit 9.7E-172 633 1083
PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain 4.7E-74 227 451
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 8.7E-49 87 223
PF12769 PNTB_4TM 4TM region of pyridine nucleotide transhydrogenase, mitoch 1.2E-29 514 598

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 34 1091 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 70 1091 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 75 1091 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 86 598 7.0E-162
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 84 598 4.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 34 1091 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 70 1091 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 75 1091 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 86 598 7.0E-162
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 84 598 4.0E-157
sp|P43842|PNTA_HAEIN NAD(P) transhydrogenase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntA PE=3 SV=1 84 598 3.0E-156
sp|P0AB70|PNTB_SHIFL NAD(P) transhydrogenase subunit beta OS=Shigella flexneri GN=pntB PE=3 SV=1 628 1086 1.0E-127
sp|P0AB67|PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) GN=pntB PE=1 SV=1 628 1086 1.0E-127
sp|P0AB68|PNTB_ECOL6 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pntB PE=3 SV=1 628 1086 1.0E-127
sp|P0AB69|PNTB_ECO57 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O157:H7 GN=pntB PE=3 SV=1 628 1086 1.0E-127
sp|P43010|PNTB_HAEIN NAD(P) transhydrogenase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntB PE=3 SV=1 630 1086 5.0E-124
sp|P0C188|PNTB_RHORU NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum GN=pntB PE=1 SV=1 631 1087 1.0E-104
sp|Q2RSB4|PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntB PE=1 SV=1 631 1087 1.0E-104
sp|P0C186|PNTAA_RHORU NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum GN=pntAA PE=3 SV=1 84 454 5.0E-96
sp|Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAA PE=1 SV=1 84 454 5.0E-96
sp|P41077|PNTAA_RICPR NAD(P) transhydrogenase subunit alpha part 1 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAA PE=3 SV=2 91 457 5.0E-82
sp|Q8KY18|DHA_MYCSM Alanine dehydrogenase OS=Mycobacterium smegmatis GN=ald PE=1 SV=1 84 454 4.0E-35
sp|A0QVQ8|DHA_MYCS2 Alanine dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ald PE=1 SV=1 84 454 4.0E-35
sp|P9WQB1|DHA_MYCTU Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ald PE=1 SV=1 86 424 1.0E-34
sp|Q931P7|DHA2_STAAM Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald2 PE=3 SV=1 84 417 2.0E-34
sp|P9WQB0|DHA_MYCTO Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ald PE=3 SV=1 86 424 2.0E-34
sp|Q2YTD1|DHA2_STAAB Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald2 PE=3 SV=1 84 417 2.0E-34
sp|Q99TF4|DHA2_STAAN Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=ald2 PE=1 SV=1 84 417 2.0E-34
sp|Q6GFZ8|DHA2_STAAR Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=ald2 PE=3 SV=1 84 417 2.0E-34
sp|Q8NW54|DHA2_STAAW Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=ald2 PE=3 SV=1 84 417 3.0E-34
sp|Q6G8L8|DHA2_STAAS Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=ald2 PE=3 SV=1 84 417 3.0E-34
sp|Q5HF65|DHA2_STAAC Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=ald2 PE=3 SV=1 84 417 3.0E-34
sp|Q2FXL7|DHA2_STAA8 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald2 PE=3 SV=1 84 417 3.0E-34
sp|Q2FG29|DHA2_STAA3 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain USA300) GN=ald2 PE=3 SV=1 84 417 3.0E-34
sp|Q4L750|DHA_STAHJ Alanine dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ald PE=3 SV=1 84 417 4.0E-33
sp|Q8CNW8|DHA_STAES Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ald PE=3 SV=1 84 417 4.0E-32
sp|Q5HNJ6|DHA_STAEQ Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ald PE=3 SV=1 84 417 4.0E-32
sp|Q08352|DHA_BACSU Alanine dehydrogenase OS=Bacillus subtilis (strain 168) GN=ald PE=1 SV=1 84 426 7.0E-32
sp|Q49YD9|DHA_STAS1 Alanine dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ald PE=3 SV=1 84 417 1.0E-30
sp|P17556|DHA_LYSSH Alanine dehydrogenase OS=Lysinibacillus sphaericus GN=ald PE=1 SV=1 84 426 1.0E-29
sp|Q8CX61|DHA_OCEIH Alanine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ald PE=3 SV=1 84 426 4.0E-29
sp|Q6GGW9|DHA1_STAAR Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=ald1 PE=3 SV=1 84 446 8.0E-26
sp|Q8NWQ3|DHA1_STAAW Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=ald1 PE=3 SV=1 84 446 9.0E-26
sp|Q6G9C3|DHA1_STAAS Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=ald1 PE=3 SV=1 84 446 9.0E-26
sp|P99151|DHA1_STAAN Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=ald1 PE=1 SV=1 84 446 9.0E-26
sp|P63478|DHA1_STAAM Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald1 PE=3 SV=1 84 446 9.0E-26
sp|Q5HFY4|DHA1_STAAC Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=ald1 PE=3 SV=1 84 446 9.0E-26
sp|Q2FH00|DHA1_STAA3 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain USA300) GN=ald1 PE=3 SV=1 84 446 9.0E-26
sp|P17557|DHA_GEOSE Alanine dehydrogenase OS=Geobacillus stearothermophilus GN=ald PE=1 SV=1 84 454 5.0E-25
sp|Q2FYJ2|DHA1_STAA8 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald1 PE=3 SV=1 84 446 9.0E-25
sp|Q2YY66|DHA1_STAAB Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald1 PE=3 SV=1 84 449 1.0E-24
sp|Q6LX40|DHA_METMP Alanine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=ald PE=1 SV=1 84 426 1.0E-23
sp|P51995|PNTAB_RICPR NAD(P) transhydrogenase subunit alpha part 2 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAB PE=3 SV=2 516 598 6.0E-19
sp|P0C187|PNTAB_RHORU NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum GN=pntAB PE=3 SV=1 516 598 5.0E-18
sp|Q2RSB3|PNTAB_RHORT NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAB PE=3 SV=1 516 598 5.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 506 528 22
2 540 562 22
3 566 588 22
4 605 624 19
5 629 651 22
6 658 680 22
7 684 703 19
8 716 738 22
9 748 770 22
10 791 813 22
11 828 850 22
12 862 884 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5913
MAPSSLRCRPPPCLARACLEDSLHLRPFLTRRRPWLAGFVSCARPASVLAVPRALPLLRRAPTCLPRLPYSTAIV
PPTKPYHDLCVGVPSEIFPGERRVALTPANVALLLKKGFKEVLVQRGAGAAADFPDEAYKKAGATLVNDPGAVWS
AADVVLKVRAPSDQEVGCIKQGQTIVSFLQPAQNQDLVRQIADRKATCFAMDMIPRISRAQVFDALSSMANIAGY
KAVLEASNVFGRFLTGQVTAAGKIPPCKVLVIGAGVAGLSAIATARRMGAIVRGFDTRPAVREQVQSLGAEFIEV
DVQEDGSGAGGYAKEMSKEFIDAEMKLFREQAKEVDIIITTALIPGKPAPKLIKMDMLDVMKPGSVVVDLAAEAG
GNCEATKKGELTVYNDVKVIGYTDLPSRLPTQSSTLYSNNITKFLLSMAPKDKEFGIDLSDEVVRGSIVTQSGEI
VPPAPRPAPPPAPAKPAAAEVVPESVALTPWQSKVREVATVTTGMGTLLALGKFTGPLFMSNAFTFTLASLIGYR
VVWGVVPALHSPLMSVTNAISGMVGVGGLFILGGGYLPETIPQMFGALSVLLAFVNVGGGFVITKRMLDMFKRPT
DPPEYPWLYGIPAVLFGGGFIAAASTGAAGLVQAGYLASTVLCIGSLSGLASQTTARMGNMMGILGVGSGVLASL
LAAGFSPEVLAQFGGLATVGALAGFLIGKRITPTDLPQTVAALHSVVGLAAVLTSIGSVMADISNLSTLHMVSAY
LGVLVGGITFTGSIVAFLKLAGRMSSRPKILPARHAVNATLLATNVATMGAFITMAPGSPIIAAGALAANTALSF
IKGFTTTAAIGGADMPVVITVLNAYSGFALVAEGFMLGNPLLTSVGALIGVSGSILSYIMCVAMNRSLTNVLFGG
LSTPTAVQEYKPEGQVTQTSVDDLADAMLNAESVILVVGYGMAVAKAQYAISSIVSLLRSKGITVRFAIHPVAGR
MPGQCNVLLAEASVPYDIVLEMEEINDDFPETDLTVVIGANDTVNPIALEKGSAIEGMPVLHAWKSKQVVVMKRS
LASGYADVPNPMFYMPNARMLFGDARTSCEAIKTAVEAKMQ*
Coding >Hirsu2|5913
ATGGCACCCAGTTCCTTGCGCTGCCGCCCGCCGCCTTGTCTCGCCCGCGCTTGTCTTGAAGACTCACTCCATCTG
AGACCCTTTCTGACCCGGCGCCGCCCATGGCTCGCCGGCTTCGTTTCCTGCGCTCGGCCCGCCTCCGTCCTCGCC
GTCCCGAGAGCCCTGCCGCTGCTCCGACGTGCGCCGACATGCCTGCCTCGCCTCCCCTACTCGACGGCCATTGTA
CCGCCCACGAAGCCCTATCATGACCTCTGTGTCGGGGTACCCTCGGAAATCTTTCCTGGCGAGCGCCGGGTCGCC
TTGACGCCGGCGAACGTCGCCCTCCTGCTCAAAAAGGGCTTCAAAGAGGTCCTCGTCCAGCGGGGTGCCGGCGCC
GCCGCCGACTTCCCCGATGAGGCATATAAAAAGGCCGGCGCTACTCTCGTCAACGATCCTGGCGCGGTCTGGTCC
GCTGCCGATGTCGTCCTCAAGGTGCGCGCCCCGTCCGACCAGGAGGTCGGCTGTATCAAGCAGGGCCAGACCATC
GTTTCCTTCCTGCAGCCCGCCCAGAACCAAGACCTCGTGCGCCAGATTGCCGACAGGAAAGCGACCTGCTTCGCC
ATGGACATGATCCCCCGCATATCGCGCGCCCAAGTTTTTGACGCCCTCAGCAGCATGGCAAATATTGCCGGCTAC
AAGGCCGTCCTCGAAGCCTCCAACGTCTTCGGCAGGTTTCTGACCGGCCAGGTCACCGCCGCCGGCAAGATCCCC
CCATGCAAGGTCCTCGTCATTGGCGCCGGCGTCGCCGGGCTGAGTGCCATCGCCACCGCCCGTCGCATGGGTGCC
ATCGTCCGCGGCTTCGACACCCGGCCCGCCGTGAGGGAGCAGGTCCAGTCGCTGGGAGCCGAGTTCATCGAAGTC
GATGTCCAGGAGGACGGCTCCGGCGCCGGAGGCTATGCCAAGGAGATGAGCAAGGAGTTTATCGATGCCGAGATG
AAGCTGTTCCGCGAGCAAGCTAAAGAGGTCGACATCATCATTACCACCGCTCTCATCCCCGGAAAGCCTGCTCCC
AAGCTCATCAAGATGGACATGCTGGACGTCATGAAGCCGGGCAGCGTCGTTGTCGACCTGGCTGCCGAGGCCGGC
GGCAACTGCGAGGCAACCAAGAAGGGCGAGCTGACCGTCTACAATGATGTAAAGGTCATCGGATACACCGACCTG
CCTTCTCGGCTGCCGACGCAGTCCTCGACGCTCTACTCCAACAACATCACCAAGTTCCTGCTCTCCATGGCCCCC
AAGGACAAGGAGTTTGGCATCGACCTCTCCGACGAAGTCGTGCGTGGCTCTATCGTGACCCAGAGCGGCGAAATC
GTCCCGCCCGCCCCTCGGCCGGCGCCGCCCCCCGCCCCCGCGAAGCCGGCGGCGGCCGAGGTCGTGCCCGAGTCC
GTAGCCCTCACGCCGTGGCAGTCCAAAGTTCGCGAAGTCGCCACCGTCACCACCGGCATGGGGACTCTCCTGGCT
CTCGGCAAGTTCACCGGGCCTCTCTTCATGTCCAACGCCTTCACCTTCACACTCGCCAGCTTGATCGGATATCGC
GTCGTCTGGGGCGTCGTACCGGCCCTGCATTCCCCGCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGC
GTCGGCGGCCTCTTCATTCTCGGCGGAGGGTACCTGCCCGAGACCATTCCCCAGATGTTTGGGGCCTTGAGCGTC
TTGCTGGCCTTTGTCAATGTCGGTGGTGGCTTCGTCATCACGAAGAGAATGCTGGACATGTTCAAACGGCCGACC
GACCCTCCGGAGTATCCGTGGTTGTATGGAATACCCGCCGTACTGTTTGGCGGCGGCTTCATTGCGGCCGCCTCG
ACCGGCGCCGCCGGCCTCGTGCAAGCCGGCTACCTCGCCAGCACCGTCCTCTGCATCGGATCTCTGTCCGGTCTC
GCGTCGCAGACCACGGCGCGGATGGGCAACATGATGGGCATCCTCGGCGTAGGATCCGGTGTCCTGGCCAGCCTG
CTGGCCGCCGGCTTCTCCCCCGAGGTCCTTGCCCAGTTTGGAGGCCTCGCAACTGTCGGCGCCCTCGCAGGTTTC
CTGATCGGCAAGCGCATCACGCCGACGGATCTTCCTCAGACCGTTGCCGCCTTGCACTCGGTCGTCGGCTTGGCG
GCTGTCCTGACAAGCATCGGTAGCGTCATGGCGGATATATCGAATTTGTCGACGCTGCATATGGTCAGCGCCTAC
CTTGGCGTCCTCGTCGGTGGCATCACCTTTACCGGATCCATCGTTGCCTTCCTCAAACTGGCCGGCCGCATGTCG
TCTCGCCCAAAGATCCTACCCGCCCGACACGCGGTCAATGCAACTCTGCTGGCCACCAATGTGGCCACGATGGGT
GCCTTCATTACCATGGCGCCGGGTAGCCCTATAATTGCCGCAGGAGCCCTGGCAGCAAACACGGCCCTGAGCTTC
ATCAAGGGGTTCACCACCACTGCGGCTATCGGAGGCGCGGACATGCCGGTCGTCATCACCGTTCTCAATGCATAC
AGCGGATTCGCGCTTGTCGCCGAGGGTTTCATGCTTGGCAACCCGCTGCTCACCTCGGTCGGCGCCCTGATCGGG
GTGTCCGGCTCGATCCTGTCGTACATTATGTGTGTCGCGATGAACCGATCTCTGACCAACGTCTTATTCGGCGGC
CTGTCGACGCCGACTGCGGTCCAAGAATACAAGCCGGAGGGCCAGGTGACGCAGACGTCGGTCGACGACTTGGCC
GACGCCATGCTCAACGCCGAGTCGGTTATTCTCGTTGTGGGATACGGAATGGCCGTGGCCAAGGCGCAGTACGCC
ATCTCCAGCATCGTATCCCTGCTGCGGTCCAAGGGCATCACGGTCCGTTTCGCCATCCATCCCGTCGCCGGCCGG
ATGCCGGGTCAGTGCAACGTGCTGCTCGCCGAGGCCAGCGTACCCTACGACATTGTGCTGGAGATGGAAGAGATC
AACGACGACTTCCCGGAAACGGACTTGACGGTCGTGATTGGCGCCAACGACACCGTCAATCCCATCGCCCTGGAG
AAGGGGAGCGCGATAGAGGGCATGCCTGTCCTGCACGCCTGGAAGAGCAAGCAGGTAGTCGTCATGAAGAGAAGC
TTGGCCAGCGGCTACGCCGATGTGCCGAATCCAATGTTCTACATGCCCAATGCCCGAATGCTGTTCGGAGACGCC
AGGACGAGCTGCGAAGCTATCAAGACTGCCGTGGAAGCCAAGATGCAGTAG
Transcript >Hirsu2|5913
ATGGCACCCAGTTCCTTGCGCTGCCGCCCGCCGCCTTGTCTCGCCCGCGCTTGTCTTGAAGACTCACTCCATCTG
AGACCCTTTCTGACCCGGCGCCGCCCATGGCTCGCCGGCTTCGTTTCCTGCGCTCGGCCCGCCTCCGTCCTCGCC
GTCCCGAGAGCCCTGCCGCTGCTCCGACGTGCGCCGACATGCCTGCCTCGCCTCCCCTACTCGACGGCCATTGTA
CCGCCCACGAAGCCCTATCATGACCTCTGTGTCGGGGTACCCTCGGAAATCTTTCCTGGCGAGCGCCGGGTCGCC
TTGACGCCGGCGAACGTCGCCCTCCTGCTCAAAAAGGGCTTCAAAGAGGTCCTCGTCCAGCGGGGTGCCGGCGCC
GCCGCCGACTTCCCCGATGAGGCATATAAAAAGGCCGGCGCTACTCTCGTCAACGATCCTGGCGCGGTCTGGTCC
GCTGCCGATGTCGTCCTCAAGGTGCGCGCCCCGTCCGACCAGGAGGTCGGCTGTATCAAGCAGGGCCAGACCATC
GTTTCCTTCCTGCAGCCCGCCCAGAACCAAGACCTCGTGCGCCAGATTGCCGACAGGAAAGCGACCTGCTTCGCC
ATGGACATGATCCCCCGCATATCGCGCGCCCAAGTTTTTGACGCCCTCAGCAGCATGGCAAATATTGCCGGCTAC
AAGGCCGTCCTCGAAGCCTCCAACGTCTTCGGCAGGTTTCTGACCGGCCAGGTCACCGCCGCCGGCAAGATCCCC
CCATGCAAGGTCCTCGTCATTGGCGCCGGCGTCGCCGGGCTGAGTGCCATCGCCACCGCCCGTCGCATGGGTGCC
ATCGTCCGCGGCTTCGACACCCGGCCCGCCGTGAGGGAGCAGGTCCAGTCGCTGGGAGCCGAGTTCATCGAAGTC
GATGTCCAGGAGGACGGCTCCGGCGCCGGAGGCTATGCCAAGGAGATGAGCAAGGAGTTTATCGATGCCGAGATG
AAGCTGTTCCGCGAGCAAGCTAAAGAGGTCGACATCATCATTACCACCGCTCTCATCCCCGGAAAGCCTGCTCCC
AAGCTCATCAAGATGGACATGCTGGACGTCATGAAGCCGGGCAGCGTCGTTGTCGACCTGGCTGCCGAGGCCGGC
GGCAACTGCGAGGCAACCAAGAAGGGCGAGCTGACCGTCTACAATGATGTAAAGGTCATCGGATACACCGACCTG
CCTTCTCGGCTGCCGACGCAGTCCTCGACGCTCTACTCCAACAACATCACCAAGTTCCTGCTCTCCATGGCCCCC
AAGGACAAGGAGTTTGGCATCGACCTCTCCGACGAAGTCGTGCGTGGCTCTATCGTGACCCAGAGCGGCGAAATC
GTCCCGCCCGCCCCTCGGCCGGCGCCGCCCCCCGCCCCCGCGAAGCCGGCGGCGGCCGAGGTCGTGCCCGAGTCC
GTAGCCCTCACGCCGTGGCAGTCCAAAGTTCGCGAAGTCGCCACCGTCACCACCGGCATGGGGACTCTCCTGGCT
CTCGGCAAGTTCACCGGGCCTCTCTTCATGTCCAACGCCTTCACCTTCACACTCGCCAGCTTGATCGGATATCGC
GTCGTCTGGGGCGTCGTACCGGCCCTGCATTCCCCGCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGC
GTCGGCGGCCTCTTCATTCTCGGCGGAGGGTACCTGCCCGAGACCATTCCCCAGATGTTTGGGGCCTTGAGCGTC
TTGCTGGCCTTTGTCAATGTCGGTGGTGGCTTCGTCATCACGAAGAGAATGCTGGACATGTTCAAACGGCCGACC
GACCCTCCGGAGTATCCGTGGTTGTATGGAATACCCGCCGTACTGTTTGGCGGCGGCTTCATTGCGGCCGCCTCG
ACCGGCGCCGCCGGCCTCGTGCAAGCCGGCTACCTCGCCAGCACCGTCCTCTGCATCGGATCTCTGTCCGGTCTC
GCGTCGCAGACCACGGCGCGGATGGGCAACATGATGGGCATCCTCGGCGTAGGATCCGGTGTCCTGGCCAGCCTG
CTGGCCGCCGGCTTCTCCCCCGAGGTCCTTGCCCAGTTTGGAGGCCTCGCAACTGTCGGCGCCCTCGCAGGTTTC
CTGATCGGCAAGCGCATCACGCCGACGGATCTTCCTCAGACCGTTGCCGCCTTGCACTCGGTCGTCGGCTTGGCG
GCTGTCCTGACAAGCATCGGTAGCGTCATGGCGGATATATCGAATTTGTCGACGCTGCATATGGTCAGCGCCTAC
CTTGGCGTCCTCGTCGGTGGCATCACCTTTACCGGATCCATCGTTGCCTTCCTCAAACTGGCCGGCCGCATGTCG
TCTCGCCCAAAGATCCTACCCGCCCGACACGCGGTCAATGCAACTCTGCTGGCCACCAATGTGGCCACGATGGGT
GCCTTCATTACCATGGCGCCGGGTAGCCCTATAATTGCCGCAGGAGCCCTGGCAGCAAACACGGCCCTGAGCTTC
ATCAAGGGGTTCACCACCACTGCGGCTATCGGAGGCGCGGACATGCCGGTCGTCATCACCGTTCTCAATGCATAC
AGCGGATTCGCGCTTGTCGCCGAGGGTTTCATGCTTGGCAACCCGCTGCTCACCTCGGTCGGCGCCCTGATCGGG
GTGTCCGGCTCGATCCTGTCGTACATTATGTGTGTCGCGATGAACCGATCTCTGACCAACGTCTTATTCGGCGGC
CTGTCGACGCCGACTGCGGTCCAAGAATACAAGCCGGAGGGCCAGGTGACGCAGACGTCGGTCGACGACTTGGCC
GACGCCATGCTCAACGCCGAGTCGGTTATTCTCGTTGTGGGATACGGAATGGCCGTGGCCAAGGCGCAGTACGCC
ATCTCCAGCATCGTATCCCTGCTGCGGTCCAAGGGCATCACGGTCCGTTTCGCCATCCATCCCGTCGCCGGCCGG
ATGCCGGGTCAGTGCAACGTGCTGCTCGCCGAGGCCAGCGTACCCTACGACATTGTGCTGGAGATGGAAGAGATC
AACGACGACTTCCCGGAAACGGACTTGACGGTCGTGATTGGCGCCAACGACACCGTCAATCCCATCGCCCTGGAG
AAGGGGAGCGCGATAGAGGGCATGCCTGTCCTGCACGCCTGGAAGAGCAAGCAGGTAGTCGTCATGAAGAGAAGC
TTGGCCAGCGGCTACGCCGATGTGCCGAATCCAATGTTCTACATGCCCAATGCCCGAATGCTGTTCGGAGACGCC
AGGACGAGCTGCGAAGCTATCAAGACTGCCGTGGAAGCCAAGATGCAGTAG
Gene >Hirsu2|5913
ATGGCACCCAGTTCCTTGCGCTGCCGCCCGCCGCCTTGTCTCGCCCGCGCTTGTCTTGAAGGTGCCCCCTCCTGT
CCCTTGTCTCGAGCCATTCGCCGCTGACTGCCTATTGACTTTCCTTGACAGACTCACTCCATCTGAGACCCTTTC
TGACCCGGCGCCGCCCATGGCTCGCCGGCTTCGTTTCCTGCGCTCGGCCCGCCTCCGTCCTCGCCGTCCCGAGAG
CCCTGCCGCTGCTCCGACGTGCGCCGACATGCCTGCCTCGCCTCCCCTACTCGACGGCCATTGTACCGCCCACGA
AGCCCTATCATGACCTCTGTGTCGGGGTACCCTCGGAAATCTTTCCTGGCGAGCGCCGGGTCGCCTTGACGCCGG
CGAACGTCGCCCTCCTGCTCAAAAAGGGCTTCAAAGAGGTCCTCGTCCAGCGGGGTGCCGGCGCCGCCGCCGACT
TCCCCGATGAGGCATATAAAAAGGCCGGCGCTACTCTCGTCAACGATCCTGGCGCGGTCTGGTCCGCTGCCGATG
TCGTCCTCAAGGTGCGCGCCCCGTCCGACCAGGAGGTCGGCTGTATCAAGCAGGGCCAGACCATCGTTTCCTTCC
TGCAGCCCGCCCAGAACCAAGACCTCGTGCGCCAGATTGCCGACAGGAAAGCGACCTGCTTCGCCATGGACATGA
TCCCCCGCATATCGCGCGCCCAAGTTTTTGACGCCCTCAGCAGCATGGCAAATATTGCCGGCTACAAGGCCGTCC
TCGAAGCCTCCAACGTCTTCGGCAGGTTTCTGACCGGCCAGGTCACCGCCGCCGGCAAGATCCCCCCATGCAAGG
TCCTCGTCATTGGCGCCGGCGTCGCCGGGCTGAGTGCCATCGCCACCGCCCGTCGCATGGGTGCCATCGTCCGCG
GCTTCGACACCCGGCCCGCCGTGAGGGAGCAGGTCCAGTCGCTGGGAGCCGAGTTCATCGAAGTCGATGTCCAGG
AGGACGGCTCCGGCGCCGGAGGCTATGCCAAGGAGATGAGCAAGGAGTTTATCGATGCCGAGATGAAGCTGTTCC
GCGAGCAAGCTAAAGAGGTCGACATCATCATTACCACCGCTCTCATCCCCGGAAAGCCTGCTCCCAAGCTCATCA
AGATGGACATGCTGGACGTCATGAAGCCGGGCAGCGTCGTTGTCGACCTGGCTGCCGAGGCCGGCGGCAACTGCG
AGGCAACCAAGAAGGGCGAGCTGACCGTCTACAATGATGTAAAGGTCATCGGTGCGTAGCCCTTGGGGCGCAGAC
TTGGCCACGGGTTGCTCACTAACGCCGGACTGACTGCCAGGATACACCGACCTGCCTTCTCGGCTGCCGACGCAG
TCCTCGACGCTCTACTCCAACAACATCACCAAGTTCCTGCTCTCCATGGCCCCCAAGGACAAGGAGTTTGGCATC
GACCTCTCCGACGAAGTCGTGCGTGGCTCTATCGTGACCCAGAGCGGCGAAATCGTCCCGCCCGCCCCTCGGCCG
GCGCCGCCCCCCGCCCCCGCGAAGCCGGCGGCGGCCGAGGTCGTGCCCGAGTCCGTAGCCCTCACGCCGTGGCAG
TCCAAAGTTCGCGAAGTCGCCACCGTCACCACCGGCATGGGGACTCTCCTGGCTCTCGGCAAGTTCACCGGGCCT
CTCTTCATGTCCAACGCCTTCACCTTCACACTCGCCAGCTTGATCGGATATCGCGTCGTCTGGGGCGTCGTACCG
GCCCTGCATTCCCCGCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGCGTCGGCGGCCTCTTCATTCTC
GGCGGAGGGTACCTGCCCGAGACCATTCCCCAGATGTTTGGGGCCTTGAGCGTCTTGCTGGCCTTTGTCAATGTC
GGTGGTGGCTTCGTCATCACGAAGAGAATGCTGGACATGTTCAAACGTGAGCATCAGATCGCCGGCGGGTATCAT
GGCGGCCTCGGCGGATGCTGACACGGCTTGCAGGGCCGACCGACCCTCCGGAGTATCCGTGGTTGTATGGAATAC
CCGCCGTACTGTTTGGCGGCGGCTTCATTGCGGCCGCCTCGACCGGCGCCGCCGGCCTCGTGCAAGCCGGCTACC
TCGCCAGCACCGTCCTCTGCATCGGATCTCTGTCCGGTCTCGCGTCGCAGACCACGGCGCGGATGGGCAACATGA
TGGGCATCCTCGGCGTAGGATCCGGTGTCCTGGCCAGCCTGCTGGCCGCCGGCTTCTCCCCCGAGGTCCTTGCCC
AGTTTGGAGGCCTCGCAACTGTCGGCGCCCTCGCAGGTATGCGGATTTGTTACGGAGATTGGCCAAGTCGGCTGG
GTGCTCACATGCGCCCTAGGTTTCCTGATCGGCAAGCGCATCACGCCGACGGATCTTCCTCAGACCGTTGCCGCC
TTGCACTCGGTCGTCGGCTTGGCGGCTGTCCTGACAAGCATCGGTAGCGTCATGGCGGATATATCGAATTTGTCG
ACGCTGCATATGGTCAGCGCCTACCTTGGCGTCCTCGTCGGTAGGCTTCTCTGCTTATTTTCCTGAAGATTTCCT
GTCGCGAATTTGTCATTCTGGGCGATGGCTCCGTACTGACTTTGACGAGGTGGCATCACCTTTACCGGATCCATC
GTTGCCTTCCTCAAACTGGCCGGCCGCATGTCGTCTCGCCCAAAGATCCTACCCGCCCGACACGCGGTCAATGCA
ACTCTGCTGGCCACCAATGTGGCCACGATGGGTGCCTTCATTACCATGGCGCCGGGTAGCCCTATAATTGCCGCA
GGAGCCCTGGCAGCAAACACGGCCCTGAGCTTCATCAAGGGGTTCACCACCACTGCGGCTATCGGAGGCGCGGAC
ATGCGTAAGTCATGAGAACCCGCACCCCGGAGATGCGAAGGGACGAATGCTGACACTTACCACGCCGCAGCGGTC
GTCATCACCGTTCTCAATGCATACAGCGGATTCGCGCTTGTCGCCGAGGGTTTCATGCTTGGCAACCCGCTGCTC
ACCTCGGTCGGCGCCCTGATCGGGGTGTCCGGCTCGATCCTGTCGTACATTATGTGTGTCGCGATGAACCGATCT
CTGACCAACGTCTTATTCGGCGGCCTGTCGACGCCGACTGCGGTCCAAGAATACAAGCCGGAGGGCCAGGTGACG
CAGACGTCGGTCGACGACTTGGCCGACGCCATGCTCAACGCCGAGTCGGTTATTCTCGTTGTGGGATACGGAATG
GCCGTGGCCAAGGCGCAGTACGCCATCTCCAGCATCGTATCCCTGCTGCGGTCCAAGGGCATCACGGTCCGTTTC
GCCATCCATCCCGTCGCCGGCCGGATGCCGGGTCAGTGCAACGTGCTGCTCGCCGAGGCCAGCGTACCCTACGAC
ATTGTGCTGGAGATGGAAGAGATCAACGACGACTTCCCGGAAACGGACTTGACGGTCGTGATTGGCGCCAACGAC
ACCGTCAATCCCATCGCCCTGGAGAAGGGGAGCGCGATAGAGGGCATGCCTGTCCTGCACGCCTGGAAGAGCAAG
CAGGTAGTCGTCATGAAGAGAAGCTTGGCCAGCGGCTACGGTAAGTCGAGCTTCTCCGGCCCGGCCCTCCGAGAG
CGAGAGGGAGGCTTTCTGACGCGCGAGACAGCCGATGTGCCGAATCCAATGTTCTACATGCCCAATGCCCGAATG
CTGTTCGGAGACGCCAGGACGAGCTGCGAAGGTAGGCCTGATCGTGGACTTGGTGAACGAGAAATGCTGACAGCC
GCGTAGCTATCAAGACTGCCGTGGAAGCCAAGATGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail