Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5911
Gene name
LocationContig_3:3577..4654
Strand-
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain 5.2E-78 29 246
PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain 6.3E-16 260 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW51|HEM3_NEUCR Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 29 353 1.0E-111
sp|Q6C097|HEM3_YARLI Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 27 345 8.0E-99
sp|O94048|HEM3_CANAL Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1 30 352 4.0E-92
sp|Q6BM23|HEM3_DEBHA Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 30 358 5.0E-88
sp|Q8DIE4|HEM3_THEEB Porphobilinogen deaminase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemC PE=3 SV=1 30 349 7.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW51|HEM3_NEUCR Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 29 353 1.0E-111
sp|Q6C097|HEM3_YARLI Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 27 345 8.0E-99
sp|O94048|HEM3_CANAL Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1 30 352 4.0E-92
sp|Q6BM23|HEM3_DEBHA Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 30 358 5.0E-88
sp|Q8DIE4|HEM3_THEEB Porphobilinogen deaminase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemC PE=3 SV=1 30 349 7.0E-88
sp|Q6FNR4|HEM3_CANGA Porphobilinogen deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM3 PE=3 SV=1 28 348 1.0E-87
sp|Q75DY0|HEM3_ASHGO Porphobilinogen deaminase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM3 PE=3 SV=1 28 345 3.0E-86
sp|P28789|HEM3_YEAST Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM3 PE=1 SV=1 28 348 5.0E-86
sp|Q8YVU6|HEM3_NOSS1 Porphobilinogen deaminase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemC PE=3 SV=2 23 346 2.0E-82
sp|P73660|HEM3_SYNY3 Porphobilinogen deaminase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemC PE=3 SV=1 23 346 2.0E-82
sp|Q31PM2|HEM3_SYNE7 Porphobilinogen deaminase OS=Synechococcus elongatus (strain PCC 7942) GN=hemC PE=3 SV=1 23 303 6.0E-82
sp|A2C0V4|HEM3_PROM1 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL1A) GN=hemC PE=3 SV=1 28 344 1.0E-81
sp|Q46GS7|HEM3_PROMT Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL2A) GN=hemC PE=3 SV=1 28 344 8.0E-81
sp|Q2KIN5|HEM3_BOVIN Porphobilinogen deaminase OS=Bos taurus GN=HMBS PE=2 SV=1 18 343 9.0E-81
sp|P22907|HEM3_MOUSE Porphobilinogen deaminase OS=Mus musculus GN=Hmbs PE=1 SV=2 21 343 1.0E-80
sp|P08397|HEM3_HUMAN Porphobilinogen deaminase OS=Homo sapiens GN=HMBS PE=1 SV=2 18 342 1.0E-80
sp|A5GSE0|HEM3_SYNR3 Porphobilinogen deaminase OS=Synechococcus sp. (strain RCC307) GN=hemC PE=3 SV=1 25 349 5.0E-80
sp|Q6CT60|HEM3_KLULA Porphobilinogen deaminase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEM3 PE=3 SV=1 30 345 8.0E-80
sp|Q7VD89|HEM3_PROMA Porphobilinogen deaminase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hemC PE=3 SV=1 30 344 8.0E-80
sp|P19356|HEM3_RAT Porphobilinogen deaminase OS=Rattus norvegicus GN=Hmbs PE=1 SV=2 21 343 8.0E-80
sp|A2BVF7|HEM3_PROM5 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemC PE=3 SV=1 28 344 3.0E-79
sp|Q31C38|HEM3_PROM9 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemC PE=3 SV=1 28 344 2.0E-78
sp|A8G3L1|HEM3_PROM2 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemC PE=3 SV=1 28 344 2.0E-78
sp|Q09899|HEM3_SCHPO Porphobilinogen deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem3 PE=1 SV=2 24 342 3.0E-78
sp|Q7V2I1|HEM3_PROMP Porphobilinogen deaminase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemC PE=3 SV=1 28 344 4.0E-78
sp|Q3ALS9|HEM3_SYNSC Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9605) GN=hemC PE=3 SV=1 24 349 4.0E-77
sp|Q7V697|HEM3_PROMM Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemC PE=3 SV=1 26 349 4.0E-77
sp|A2C7L8|HEM3_PROM3 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9303) GN=hemC PE=3 SV=1 26 349 1.0E-76
sp|A2BPX7|HEM3_PROMS Porphobilinogen deaminase OS=Prochlorococcus marinus (strain AS9601) GN=hemC PE=3 SV=1 28 344 2.0E-76
sp|Q7NGF7|HEM3_GLOVI Porphobilinogen deaminase OS=Gloeobacter violaceus (strain PCC 7421) GN=hemC PE=3 SV=1 30 355 1.0E-75
sp|A3PBM0|HEM3_PROM0 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemC PE=3 SV=1 28 344 1.0E-75
sp|Q7U5C2|HEM3_SYNPX Porphobilinogen deaminase OS=Synechococcus sp. (strain WH8102) GN=hemC PE=3 SV=1 24 349 2.0E-75
sp|A9BEB6|HEM3_PROM4 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9211) GN=hemC PE=3 SV=1 28 344 9.0E-75
sp|Q0I8I3|HEM3_SYNS3 Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9311) GN=hemC PE=3 SV=1 28 344 2.0E-74
sp|Q54P93|HEM3_DICDI Porphobilinogen deaminase OS=Dictyostelium discoideum GN=hemC PE=3 SV=1 30 341 5.0E-73
sp|Q3AWQ4|HEM3_SYNS9 Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9902) GN=hemC PE=3 SV=1 24 349 6.0E-73
sp|C1D679|HEM3_LARHH Porphobilinogen deaminase OS=Laribacter hongkongensis (strain HLHK9) GN=hemC PE=3 SV=1 30 347 3.0E-69
sp|A1AUE7|HEM3_PELPD Porphobilinogen deaminase OS=Pelobacter propionicus (strain DSM 2379) GN=hemC PE=3 SV=1 28 344 4.0E-69
sp|Q602K3|HEM3_METCA Porphobilinogen deaminase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hemC PE=3 SV=2 24 346 1.0E-67
sp|A6VL87|HEM3_ACTSZ Porphobilinogen deaminase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=hemC PE=3 SV=1 27 344 2.0E-67
sp|Q3A009|HEM3_PELCD Porphobilinogen deaminase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hemC PE=3 SV=1 24 351 2.0E-67
sp|Q65VX7|HEM3_MANSM Porphobilinogen deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hemC PE=3 SV=1 28 344 1.0E-66
sp|Q7P207|HEM3_CHRVO Porphobilinogen deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemC PE=3 SV=2 30 346 2.0E-66
sp|A4J6H7|HEM3_DESRM Porphobilinogen deaminase OS=Desulfotomaculum reducens (strain MI-1) GN=hemC PE=3 SV=1 28 346 4.0E-66
sp|B1I4L8|HEM3_DESAP Porphobilinogen deaminase OS=Desulforudis audaxviator (strain MP104C) GN=hemC PE=3 SV=1 30 346 6.0E-66
sp|C0ZAH1|HEM3_BREBN Porphobilinogen deaminase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemC PE=3 SV=1 28 344 9.0E-66
sp|Q3SFT5|HEM3_THIDA Porphobilinogen deaminase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemC PE=3 SV=1 28 346 3.0E-65
sp|B3EIN1|HEM3_CHLL2 Porphobilinogen deaminase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemC PE=3 SV=1 30 348 4.0E-65
sp|Q48AW8|HEM3_COLP3 Porphobilinogen deaminase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hemC PE=3 SV=1 26 344 5.0E-65
sp|A1WVT9|HEM3_HALHL Porphobilinogen deaminase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hemC PE=3 SV=1 24 344 9.0E-65
sp|Q82WS2|HEM3_NITEU Porphobilinogen deaminase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemC PE=3 SV=1 30 344 1.0E-64
sp|Q65GK1|HEM3_BACLD Porphobilinogen deaminase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hemC PE=3 SV=1 30 303 1.0E-64
sp|P16616|HEM3_BACSU Porphobilinogen deaminase OS=Bacillus subtilis (strain 168) GN=hemC PE=3 SV=3 28 345 2.0E-64
sp|Q5KWK6|HEM3_GEOKA Porphobilinogen deaminase OS=Geobacillus kaustophilus (strain HTA426) GN=hemC PE=3 SV=1 30 345 2.0E-64
sp|Q5WEP5|HEM3_BACSK Porphobilinogen deaminase OS=Bacillus clausii (strain KSM-K16) GN=hemC PE=3 SV=1 30 346 2.0E-64
sp|Q088L3|HEM3_SHEFN Porphobilinogen deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=hemC PE=3 SV=1 26 347 4.0E-64
sp|Q9K8G0|HEM3_BACHD Porphobilinogen deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemC PE=3 SV=1 30 345 5.0E-64
sp|B1KQC6|HEM3_SHEWM Porphobilinogen deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hemC PE=3 SV=1 26 344 6.0E-64
sp|A0LN73|HEM3_SYNFM Porphobilinogen deaminase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hemC PE=3 SV=1 27 347 7.0E-64
sp|Q8KCJ4|HEM3_CHLTE Porphobilinogen deaminase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemC PE=3 SV=1 30 348 8.0E-64
sp|Q3AQF5|HEM3_CHLCH Porphobilinogen deaminase OS=Chlorobium chlorochromatii (strain CaD3) GN=hemC PE=3 SV=1 30 344 1.0E-63
sp|A6TJD5|HEM3_ALKMQ Porphobilinogen deaminase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hemC PE=3 SV=1 28 345 2.0E-63
sp|B9DNE1|HEM3_STACT Porphobilinogen deaminase OS=Staphylococcus carnosus (strain TM300) GN=hemC PE=3 SV=1 30 345 2.0E-63
sp|B0TJ54|HEM3_SHEHH Porphobilinogen deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=hemC PE=3 SV=1 26 346 4.0E-63
sp|A1BHD6|HEM3_CHLPD Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hemC PE=3 SV=1 30 348 7.0E-63
sp|A1RPD7|HEM3_SHESW Porphobilinogen deaminase OS=Shewanella sp. (strain W3-18-1) GN=hemC PE=3 SV=1 28 346 8.0E-63
sp|A4YBG2|HEM3_SHEPC Porphobilinogen deaminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=hemC PE=3 SV=1 28 346 8.0E-63
sp|B2JEN9|HEM3_BURP8 Porphobilinogen deaminase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemC PE=3 SV=1 30 354 8.0E-63
sp|Q0HQI7|HEM3_SHESR Porphobilinogen deaminase OS=Shewanella sp. (strain MR-7) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q0HN99|HEM3_SHESM Porphobilinogen deaminase OS=Shewanella sp. (strain MR-4) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|A0KS60|HEM3_SHESA Porphobilinogen deaminase OS=Shewanella sp. (strain ANA-3) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q8E9H0|HEM3_SHEON Porphobilinogen deaminase OS=Shewanella oneidensis (strain MR-1) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q9CK24|HEM3_PASMU Porphobilinogen deaminase OS=Pasteurella multocida (strain Pm70) GN=hemC PE=3 SV=2 28 346 1.0E-62
sp|A8GZG4|HEM3_SHEPA Porphobilinogen deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hemC PE=3 SV=1 26 346 2.0E-62
sp|A8G0W4|HEM3_SHESH Porphobilinogen deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=hemC PE=3 SV=1 26 344 3.0E-62
sp|Q39QM7|HEM3_GEOMG Porphobilinogen deaminase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hemC PE=3 SV=1 28 341 4.0E-62
sp|A4SFJ8|HEM3_CHLPM Porphobilinogen deaminase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hemC PE=3 SV=1 30 344 5.0E-62
sp|A7Z7A5|HEM3_BACMF Porphobilinogen deaminase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hemC PE=3 SV=1 28 345 8.0E-62
sp|Q5QUS3|HEM3_IDILO Porphobilinogen deaminase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemC PE=3 SV=1 30 344 9.0E-62
sp|B7VMD9|HEM3_VIBTL Porphobilinogen deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=hemC PE=3 SV=1 28 346 9.0E-62
sp|Q87KI9|HEM3_VIBPA Porphobilinogen deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hemC PE=3 SV=1 23 346 9.0E-62
sp|B8E879|HEM3_SHEB2 Porphobilinogen deaminase OS=Shewanella baltica (strain OS223) GN=hemC PE=3 SV=1 28 346 1.0E-61
sp|B0UWZ8|HEM3_HISS2 Porphobilinogen deaminase OS=Histophilus somni (strain 2336) GN=hemC PE=3 SV=1 23 344 1.0E-61
sp|Q0I178|HEM3_HAES1 Porphobilinogen deaminase OS=Haemophilus somnus (strain 129Pt) GN=hemC PE=3 SV=1 23 344 1.0E-61
sp|A6WTG0|HEM3_SHEB8 Porphobilinogen deaminase OS=Shewanella baltica (strain OS185) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|A3D9Q4|HEM3_SHEB5 Porphobilinogen deaminase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|Q3B2Z5|HEM3_CHLL7 Porphobilinogen deaminase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hemC PE=3 SV=1 30 347 2.0E-61
sp|A9L5G0|HEM3_SHEB9 Porphobilinogen deaminase OS=Shewanella baltica (strain OS195) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|C6DHC2|HEM3_PECCP Porphobilinogen deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hemC PE=3 SV=1 25 344 3.0E-61
sp|Q6CZG3|HEM3_PECAS Porphobilinogen deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hemC PE=3 SV=1 25 344 4.0E-61
sp|Q2RJ26|HEM3_MOOTA Porphobilinogen deaminase OS=Moorella thermoacetica (strain ATCC 39073) GN=hemC PE=3 SV=1 28 346 5.0E-61
sp|B3QWI1|HEM3_CHLT3 Porphobilinogen deaminase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hemC PE=3 SV=1 30 341 5.0E-61
sp|B4SFI2|HEM3_PELPB Porphobilinogen deaminase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hemC PE=3 SV=1 30 348 6.0E-61
sp|C5D5K7|HEM3_GEOSW Porphobilinogen deaminase OS=Geobacillus sp. (strain WCH70) GN=hemC PE=3 SV=1 30 345 9.0E-61
sp|Q7MQC7|HEM3_VIBVY Porphobilinogen deaminase OS=Vibrio vulnificus (strain YJ016) GN=hemC PE=3 SV=1 23 341 9.0E-61
sp|Q8DD85|HEM3_VIBVU Porphobilinogen deaminase OS=Vibrio vulnificus (strain CMCP6) GN=hemC PE=3 SV=1 23 341 9.0E-61
sp|A8FFV2|HEM3_BACP2 Porphobilinogen deaminase OS=Bacillus pumilus (strain SAFR-032) GN=hemC PE=3 SV=1 28 303 1.0E-60
sp|A7MXU9|HEM3_VIBCB Porphobilinogen deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hemC PE=3 SV=1 23 346 1.0E-60
sp|A9MJ10|HEM3_SALAR Porphobilinogen deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemC PE=3 SV=1 26 350 1.0E-60
sp|A5D3L5|HEM3_PELTS Porphobilinogen deaminase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hemC PE=3 SV=1 30 342 1.0E-60
sp|A5GCW2|HEM3_GEOUR Porphobilinogen deaminase OS=Geobacter uraniireducens (strain Rf4) GN=hemC PE=3 SV=1 24 341 2.0E-60
sp|B5FF97|HEM3_VIBFM Porphobilinogen deaminase OS=Vibrio fischeri (strain MJ11) GN=hemC PE=3 SV=1 30 346 2.0E-60
sp|Q5E8T5|HEM3_VIBF1 Porphobilinogen deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hemC PE=3 SV=1 30 346 2.0E-60
sp|Q7MYN1|HEM3_PHOLL Porphobilinogen deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hemC PE=3 SV=1 24 350 2.0E-60
sp|Q9JVS4|HEM3_NEIMA Porphobilinogen deaminase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hemC PE=3 SV=1 30 344 2.0E-60
sp|Q9K0P6|HEM3_NEIMB Porphobilinogen deaminase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hemC PE=3 SV=1 30 344 3.0E-60
sp|B9E743|HEM3_MACCJ Porphobilinogen deaminase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hemC PE=3 SV=1 30 345 3.0E-60
sp|Q4L709|HEM3_STAHJ Porphobilinogen deaminase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemC PE=3 SV=1 30 348 4.0E-60
sp|Q747I1|HEM3_GEOSL Porphobilinogen deaminase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hemC PE=3 SV=1 28 341 5.0E-60
sp|B4F1X3|HEM3_PROMH Porphobilinogen deaminase OS=Proteus mirabilis (strain HI4320) GN=hemC PE=3 SV=1 24 350 6.0E-60
sp|B7LU53|HEM3_ESCF3 Porphobilinogen deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hemC PE=3 SV=1 26 341 7.0E-60
sp|B1J1V2|HEM3_PSEPW Porphobilinogen deaminase OS=Pseudomonas putida (strain W619) GN=hemC PE=3 SV=1 28 344 1.0E-59
sp|P28464|HEM3_CHLP8 Porphobilinogen deaminase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemC PE=3 SV=4 30 344 1.0E-59
sp|C4K4E3|HEM3_HAMD5 Porphobilinogen deaminase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=hemC PE=3 SV=1 24 345 2.0E-59
sp|B6EPK1|HEM3_ALISL Porphobilinogen deaminase OS=Aliivibrio salmonicida (strain LFI1238) GN=hemC PE=3 SV=1 30 346 2.0E-59
sp|Q02EA3|HEM3_PSEAB Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hemC PE=3 SV=1 28 344 2.0E-59
sp|A4TRA8|HEM3_YERPP Porphobilinogen deaminase OS=Yersinia pestis (strain Pestoides F) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|Q1CNI3|HEM3_YERPN Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|P46355|HEM3_YERPE Porphobilinogen deaminase OS=Yersinia pestis GN=hemC PE=3 SV=2 27 350 2.0E-59
sp|Q1CBN1|HEM3_YERPA Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|A7FD67|HEM3_YERP3 Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|Q9KVM1|HEM3_VIBCH Porphobilinogen deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hemC PE=3 SV=2 26 342 2.0E-59
sp|B2T1D1|HEM3_BURPP Porphobilinogen deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemC PE=3 SV=1 30 354 2.0E-59
sp|B8GSU8|HEM3_THISH Porphobilinogen deaminase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemC PE=3 SV=1 28 341 3.0E-59
sp|Q60169|HEM3_PSEAE Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hemC PE=3 SV=2 28 344 4.0E-59
sp|B7V5F0|HEM3_PSEA8 Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain LESB58) GN=hemC PE=3 SV=1 28 344 4.0E-59
sp|Q1I316|HEM3_PSEE4 Porphobilinogen deaminase OS=Pseudomonas entomophila (strain L48) GN=hemC PE=3 SV=1 28 344 4.0E-59
sp|B8DHJ2|HEM3_LISMH Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hemC PE=3 SV=1 30 344 4.0E-59
sp|P0A1Q8|HEM3_SALTY Porphobilinogen deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|P0A1Q9|HEM3_SALTI Porphobilinogen deaminase OS=Salmonella typhi GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B4TNV3|HEM3_SALSV Porphobilinogen deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B5BIU8|HEM3_SALPK Porphobilinogen deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|C0Q3B3|HEM3_SALPC Porphobilinogen deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|Q5PKL7|HEM3_SALPA Porphobilinogen deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B5FN93|HEM3_SALDC Porphobilinogen deaminase OS=Salmonella dublin (strain CT_02021853) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|Q6GG35|HEM3_STAAR Porphobilinogen deaminase OS=Staphylococcus aureus (strain MRSA252) GN=hemC PE=3 SV=1 30 345 5.0E-59
sp|Q2YTB9|HEM3_STAAB Porphobilinogen deaminase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hemC PE=3 SV=1 30 345 5.0E-59
sp|Q0AZ43|HEM3_SYNWW Porphobilinogen deaminase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hemC PE=3 SV=1 28 341 6.0E-59
sp|A4IRG5|HEM3_GEOTN Porphobilinogen deaminase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemC PE=3 SV=1 30 345 6.0E-59
sp|Q1GXA1|HEM3_METFK Porphobilinogen deaminase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemC PE=3 SV=1 23 344 7.0E-59
sp|Q66G00|HEM3_YERPS Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hemC PE=3 SV=1 27 350 8.0E-59
sp|B2K065|HEM3_YERPB Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hemC PE=3 SV=1 27 350 8.0E-59
sp|Q49YA2|HEM3_STAS1 Porphobilinogen deaminase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hemC PE=3 SV=1 30 345 9.0E-59
sp|B9M416|HEM3_GEODF Porphobilinogen deaminase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hemC PE=3 SV=1 28 341 9.0E-59
sp|C6DYY8|HEM3_GEOSM Porphobilinogen deaminase OS=Geobacter sp. (strain M21) GN=hemC PE=3 SV=1 28 341 1.0E-58
sp|B1JPE6|HEM3_YERPY Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hemC PE=3 SV=1 27 350 1.0E-58
sp|A8Z2J1|HEM3_STAAT Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A6QHK4|HEM3_STAAE Porphobilinogen deaminase OS=Staphylococcus aureus (strain Newman) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q5HFA2|HEM3_STAAC Porphobilinogen deaminase OS=Staphylococcus aureus (strain COL) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|O34090|HEM3_STAA8 Porphobilinogen deaminase OS=Staphylococcus aureus (strain NCTC 8325) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q2FG66|HEM3_STAA3 Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|P64341|HEM3_STAAN Porphobilinogen deaminase OS=Staphylococcus aureus (strain N315) GN=hemC PE=1 SV=1 30 345 1.0E-58
sp|P64340|HEM3_STAAM Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A5ITJ5|HEM3_STAA9 Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH9) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A6U2D8|HEM3_STAA2 Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH1) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A7X391|HEM3_STAA1 Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q8CNY8|HEM3_STAES Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemC PE=3 SV=1 30 348 1.0E-58
sp|Q5HNN3|HEM3_STAEQ Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemC PE=3 SV=1 30 348 1.0E-58
sp|A1T0R0|HEM3_PSYIN Porphobilinogen deaminase OS=Psychromonas ingrahamii (strain 37) GN=hemC PE=3 SV=1 25 341 2.0E-58
sp|B0KH05|HEM3_PSEPG Porphobilinogen deaminase OS=Pseudomonas putida (strain GB-1) GN=hemC PE=3 SV=1 28 344 2.0E-58
sp|Q8NW74|HEM3_STAAW Porphobilinogen deaminase OS=Staphylococcus aureus (strain MW2) GN=hemC PE=3 SV=1 30 345 2.0E-58
sp|Q6G8Q5|HEM3_STAAS Porphobilinogen deaminase OS=Staphylococcus aureus (strain MSSA476) GN=hemC PE=3 SV=1 30 345 2.0E-58
sp|Q59684|HEM3_PROMI Porphobilinogen deaminase OS=Proteus mirabilis GN=hemC PE=3 SV=1 26 344 2.0E-58
sp|A6TGI8|HEM3_KLEP7 Porphobilinogen deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hemC PE=3 SV=1 27 344 3.0E-58
sp|B5XYL1|HEM3_KLEP3 Porphobilinogen deaminase OS=Klebsiella pneumoniae (strain 342) GN=hemC PE=3 SV=1 27 344 3.0E-58
sp|A9R8K0|HEM3_YERPG Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hemC PE=3 SV=1 27 350 3.0E-58
sp|Q3K4T0|HEM3_PSEPF Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hemC PE=3 SV=1 28 344 4.0E-58
sp|A7MQJ1|HEM3_CROS8 Porphobilinogen deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemC PE=3 SV=1 26 341 4.0E-58
sp|Q71ZB2|HEM3_LISMF Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemC PE=3 SV=1 30 344 4.0E-58
sp|C1KVK3|HEM3_LISMC Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hemC PE=3 SV=1 30 344 4.0E-58
sp|Q0VM28|HEM3_ALCBS Porphobilinogen deaminase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hemC PE=3 SV=1 27 346 5.0E-58
sp|Q15Z15|HEM3_PSEA6 Porphobilinogen deaminase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hemC PE=3 SV=1 27 344 6.0E-58
sp|A8G848|HEM3_SERP5 Porphobilinogen deaminase OS=Serratia proteamaculans (strain 568) GN=hemC PE=3 SV=1 27 349 9.0E-58
sp|A7GTE5|HEM3_BACCN Porphobilinogen deaminase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hemC PE=3 SV=1 30 345 1.0E-57
sp|B6I4E0|HEM3_ECOSE Porphobilinogen deaminase OS=Escherichia coli (strain SE11) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|B7M603|HEM3_ECO8A Porphobilinogen deaminase OS=Escherichia coli O8 (strain IAI1) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|B7L959|HEM3_ECO55 Porphobilinogen deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|Q6FFA9|HEM3_ACIAD Porphobilinogen deaminase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hemC PE=3 SV=1 28 341 1.0E-57
sp|P06983|HEM3_ECOLI Porphobilinogen deaminase OS=Escherichia coli (strain K12) GN=hemC PE=1 SV=2 26 350 1.0E-57
sp|B1XAH2|HEM3_ECODH Porphobilinogen deaminase OS=Escherichia coli (strain K12 / DH10B) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|C4ZZ69|HEM3_ECOBW Porphobilinogen deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|A4WG12|HEM3_ENT38 Porphobilinogen deaminase OS=Enterobacter sp. (strain 638) GN=hemC PE=3 SV=1 26 349 1.0E-57
sp|B7NFA7|HEM3_ECOLU Porphobilinogen deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hemC PE=3 SV=1 26 350 2.0E-57
sp|Q8XAP3|HEM3_ECO57 Porphobilinogen deaminase OS=Escherichia coli O157:H7 GN=hemC PE=3 SV=2 26 350 2.0E-57
sp|Q2SQ70|HEM3_HAHCH Porphobilinogen deaminase OS=Hahella chejuensis (strain KCTC 2396) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|Q24VC8|HEM3_DESHY Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain Y51) GN=hemC PE=3 SV=1 29 344 2.0E-57
sp|B8G2M2|HEM3_DESHD Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hemC PE=3 SV=1 29 344 2.0E-57
sp|B7NTE0|HEM3_ECO7I Porphobilinogen deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hemC PE=3 SV=1 26 350 2.0E-57
sp|B3EPK0|HEM3_CHLPB Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain BS1) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|Q500N6|HEM3_PSEU2 Porphobilinogen deaminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|B4S922|HEM3_PROA2 Porphobilinogen deaminase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hemC PE=3 SV=1 30 344 3.0E-57
sp|Q1LU25|HEM3_BAUCH Porphobilinogen deaminase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hemC PE=3 SV=1 26 341 3.0E-57
sp|B7N295|HEM3_ECO81 Porphobilinogen deaminase OS=Escherichia coli O81 (strain ED1a) GN=hemC PE=3 SV=1 26 350 3.0E-57
sp|B7MH66|HEM3_ECO45 Porphobilinogen deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hemC PE=3 SV=1 26 350 3.0E-57
sp|Q8Y6X5|HEM3_LISMO Porphobilinogen deaminase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemC PE=3 SV=1 30 344 3.0E-57
sp|A6VE37|HEM3_PSEA7 Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain PA7) GN=hemC PE=3 SV=1 28 344 4.0E-57
sp|Q8FBP1|HEM3_ECOL6 Porphobilinogen deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hemC PE=3 SV=2 26 350 4.0E-57
sp|A1TXW9|HEM3_MARHV Porphobilinogen deaminase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemC PE=3 SV=1 28 349 4.0E-57
sp|O66621|HEM3_AQUAE Porphobilinogen deaminase OS=Aquifex aeolicus (strain VF5) GN=hemC PE=3 SV=2 30 348 4.0E-57
sp|B2VG55|HEM3_ERWT9 Porphobilinogen deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemC PE=3 SV=1 27 349 5.0E-57
sp|B5EBG8|HEM3_GEOBB Porphobilinogen deaminase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hemC PE=3 SV=1 28 341 5.0E-57
sp|Q8XWW3|HEM3_RALSO Porphobilinogen deaminase OS=Ralstonia solanacearum (strain GMI1000) GN=hemC PE=3 SV=1 13 349 7.0E-57
sp|Q88B91|HEM3_PSESM Porphobilinogen deaminase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hemC PE=3 SV=1 30 344 9.0E-57
sp|A0AJ05|HEM3_LISW6 Porphobilinogen deaminase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hemC PE=3 SV=1 30 344 1.0E-56
sp|Q83PH4|HEM3_SHIFL Porphobilinogen deaminase OS=Shigella flexneri GN=hemC PE=3 SV=2 26 350 2.0E-56
sp|Q31JG5|HEM3_THICR Porphobilinogen deaminase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemC PE=3 SV=1 28 344 3.0E-56
sp|A1JI86|HEM3_YERE8 Porphobilinogen deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hemC PE=3 SV=1 27 349 5.0E-56
sp|Q92BF8|HEM3_LISIN Porphobilinogen deaminase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemC PE=3 SV=1 30 344 5.0E-56
sp|B2G9H4|HEM3_LACRJ Porphobilinogen deaminase OS=Lactobacillus reuteri (strain JCM 1112) GN=hemC PE=3 SV=1 30 342 5.0E-56
sp|A5VM67|HEM3_LACRD Porphobilinogen deaminase OS=Lactobacillus reuteri (strain DSM 20016) GN=hemC PE=3 SV=1 30 342 5.0E-56
sp|O69110|HEM3_PAEMA Porphobilinogen deaminase OS=Paenibacillus macerans GN=hemC PE=3 SV=1 30 290 5.0E-56
sp|Q5ZRY6|HEM3_LEGPH Porphobilinogen deaminase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemC PE=3 SV=2 24 344 6.0E-56
sp|Q3ACT3|HEM3_CARHZ Porphobilinogen deaminase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hemC PE=3 SV=1 30 344 1.0E-55
sp|Q479S8|HEM3_DECAR Porphobilinogen deaminase OS=Dechloromonas aromatica (strain RCB) GN=hemC PE=3 SV=1 30 344 1.0E-55
sp|C3K424|HEM3_PSEFS Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain SBW25) GN=hemC PE=3 SV=1 28 344 1.0E-55
sp|A6Q3S1|HEM3_NITSB Porphobilinogen deaminase OS=Nitratiruptor sp. (strain SB155-2) GN=hemC PE=3 SV=1 28 342 2.0E-55
sp|Q30S90|HEM3_SULDN Porphobilinogen deaminase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hemC PE=3 SV=1 30 341 2.0E-55
sp|Q7W785|HEM3_BORPA Porphobilinogen deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemC PE=3 SV=1 28 351 2.0E-55
sp|Q7WKM1|HEM3_BORBR Porphobilinogen deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemC PE=3 SV=1 28 351 2.0E-55
sp|Q7VVU9|HEM3_BORPE Porphobilinogen deaminase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemC PE=3 SV=1 28 351 3.0E-55
sp|B1HVD6|HEM3_LYSSC Porphobilinogen deaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=hemC PE=3 SV=1 30 285 3.0E-55
sp|Q21XQ9|HEM3_RHOFT Porphobilinogen deaminase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hemC PE=3 SV=1 26 332 3.0E-55
sp|A9VIT8|HEM3_BACWK Porphobilinogen deaminase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemC PE=3 SV=1 30 345 4.0E-55
sp|Q5SLE8|HEM3_THET8 Porphobilinogen deaminase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hemC PE=3 SV=1 27 344 4.0E-55
sp|Q72H57|HEM3_THET2 Porphobilinogen deaminase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hemC PE=3 SV=1 27 344 4.0E-55
sp|Q4K3X3|HEM3_PSEF5 Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hemC PE=3 SV=1 28 344 4.0E-55
sp|Q5X1F2|HEM3_LEGPA Porphobilinogen deaminase OS=Legionella pneumophila (strain Paris) GN=hemC PE=3 SV=1 24 344 7.0E-55
sp|A5VWX3|HEM3_PSEP1 Porphobilinogen deaminase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hemC PE=3 SV=1 28 344 8.0E-55
sp|Q88RE5|HEM3_PSEPK Porphobilinogen deaminase OS=Pseudomonas putida (strain KT2440) GN=hemC PE=3 SV=1 28 344 1.0E-54
sp|Q43082|HEM3_PEA Porphobilinogen deaminase, chloroplastic OS=Pisum sativum GN=HEMC PE=1 SV=1 27 335 1.0E-54
sp|A3CL78|HEM3_STRSV Porphobilinogen deaminase OS=Streptococcus sanguinis (strain SK36) GN=hemC PE=3 SV=1 27 280 2.0E-54
sp|Q817R0|HEM3_BACCR Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|B7HE96|HEM3_BACC4 Porphobilinogen deaminase OS=Bacillus cereus (strain B4264) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|B7IIX5|HEM3_BACC2 Porphobilinogen deaminase OS=Bacillus cereus (strain G9842) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|Q5WT65|HEM3_LEGPL Porphobilinogen deaminase OS=Legionella pneumophila (strain Lens) GN=hemC PE=3 SV=1 24 344 4.0E-54
sp|A5CW34|HEM3_VESOH Porphobilinogen deaminase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hemC PE=3 SV=1 28 342 4.0E-54
sp|Q3BXV3|HEM3_XANC5 Porphobilinogen deaminase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hemC PE=3 SV=1 26 341 9.0E-54
sp|C1ETR0|HEM3_BACC3 Porphobilinogen deaminase OS=Bacillus cereus (strain 03BB102) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|A0RJ81|HEM3_BACAH Porphobilinogen deaminase OS=Bacillus thuringiensis (strain Al Hakam) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B7JQ57|HEM3_BACC0 Porphobilinogen deaminase OS=Bacillus cereus (strain AH820) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q72ZW2|HEM3_BACC1 Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q1J288|HEM3_DEIGD Porphobilinogen deaminase OS=Deinococcus geothermalis (strain DSM 11300) GN=hemC PE=3 SV=1 29 343 1.0E-53
sp|B9IZ39|HEM3_BACCQ Porphobilinogen deaminase OS=Bacillus cereus (strain Q1) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B7HQM4|HEM3_BACC7 Porphobilinogen deaminase OS=Bacillus cereus (strain AH187) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B8D8B0|HEM3_BUCAT Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|P57651|HEM3_BUCAI Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B8D8F3|HEM3_BUCA5 Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q81LC7|HEM3_BACAN Porphobilinogen deaminase OS=Bacillus anthracis GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|C3L6Z5|HEM3_BACAC Porphobilinogen deaminase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|C3P9E9|HEM3_BACAA Porphobilinogen deaminase OS=Bacillus anthracis (strain A0248) GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|Q180R9|HEM3_PEPD6 Porphobilinogen deaminase OS=Peptoclostridium difficile (strain 630) GN=hemC PE=3 SV=1 30 280 2.0E-53
sp|Q6HD62|HEM3_BACHK Porphobilinogen deaminase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemC PE=3 SV=1 30 345 3.0E-53
sp|A9IKF3|HEM3_BORPD Porphobilinogen deaminase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hemC PE=3 SV=1 30 341 4.0E-53
sp|Q6H6D2|HEM3_ORYSJ Porphobilinogen deaminase, chloroplastic OS=Oryza sativa subsp. japonica GN=HEMC PE=2 SV=1 26 304 4.0E-53
sp|A7I1S0|HEM3_CAMHC Porphobilinogen deaminase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hemC PE=3 SV=1 30 338 5.0E-53
sp|Q8CXC0|HEM3_OCEIH Porphobilinogen deaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hemC PE=3 SV=1 30 281 6.0E-53
sp|B2SMV3|HEM3_XANOP Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hemC PE=3 SV=1 26 344 7.0E-53
sp|Q2NYU4|HEM3_XANOM Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hemC PE=3 SV=1 26 344 7.0E-53
sp|Q2T071|HEM3_BURTA Porphobilinogen deaminase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hemC PE=3 SV=1 28 347 7.0E-53
sp|A0LRF1|HEM3_ACIC1 Porphobilinogen deaminase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=hemC PE=3 SV=1 23 343 8.0E-53
sp|Q633Y0|HEM3_BACCZ Porphobilinogen deaminase OS=Bacillus cereus (strain ZK / E33L) GN=hemC PE=3 SV=1 30 345 8.0E-53
sp|B1YJV1|HEM3_EXIS2 Porphobilinogen deaminase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hemC PE=3 SV=1 30 281 1.0E-52
sp|A8ERI4|HEM3_ARCB4 Porphobilinogen deaminase OS=Arcobacter butzleri (strain RM4018) GN=hemC PE=3 SV=1 30 342 2.0E-52
sp|A9KDC4|HEM3_COXBN Porphobilinogen deaminase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|B6J6K0|HEM3_COXB1 Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuK_Q154) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|Q83A37|HEM3_COXBU Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|B6J3T6|HEM3_COXB2 Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuG_Q212) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|Q8PPR3|HEM3_XANAC Porphobilinogen deaminase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hemC PE=3 SV=1 26 341 3.0E-52
sp|B1JWR0|HEM3_BURCC Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain MC0-3) GN=hemC PE=3 SV=1 28 346 3.0E-52
sp|C4L4J6|HEM3_EXISA Porphobilinogen deaminase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemC PE=3 SV=1 30 345 3.0E-52
sp|B4E8C4|HEM3_BURCJ Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hemC PE=3 SV=1 28 346 4.0E-52
sp|A9N910|HEM3_COXBR Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=hemC PE=3 SV=1 30 345 4.0E-52
sp|Q5GVL2|HEM3_XANOR Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hemC PE=3 SV=1 26 344 7.0E-52
sp|Q43316|HEM3_ARATH Porphobilinogen deaminase, chloroplastic OS=Arabidopsis thaliana GN=HEMC PE=1 SV=1 27 308 8.0E-52
sp|Q0BCU9|HEM3_BURCM Porphobilinogen deaminase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hemC PE=3 SV=1 24 350 8.0E-52
sp|A5EW83|HEM3_DICNV Porphobilinogen deaminase OS=Dichelobacter nodosus (strain VCS1703A) GN=hemC PE=3 SV=1 26 342 1.0E-51
sp|Q0A577|HEM3_ALKEH Porphobilinogen deaminase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hemC PE=3 SV=1 28 341 1.0E-51
sp|A4JGV4|HEM3_BURVG Porphobilinogen deaminase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hemC PE=3 SV=1 24 346 2.0E-51
sp|Q9RRY0|HEM3_DEIRA Porphobilinogen deaminase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hemC PE=3 SV=1 29 344 2.0E-51
sp|B0RNI9|HEM3_XANCB Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hemC PE=3 SV=1 26 341 2.0E-51
sp|P13446|HEM3_EUGGR Porphobilinogen deaminase, chloroplastic OS=Euglena gracilis PE=1 SV=1 12 303 2.0E-51
sp|A7NKU8|HEM3_ROSCS Porphobilinogen deaminase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hemC PE=3 SV=1 28 281 5.0E-51
sp|Q47LA7|HEM3_THEFY Porphobilinogen deaminase OS=Thermobifida fusca (strain YX) GN=hemC PE=3 SV=1 30 348 6.0E-51
sp|B5ERN6|HEM3_ACIF5 Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hemC PE=3 SV=1 28 310 7.0E-51
sp|B7JBH8|HEM3_ACIF2 Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hemC PE=3 SV=1 28 310 7.0E-51
sp|B3E2H7|HEM3_GEOLS Porphobilinogen deaminase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hemC PE=3 SV=1 28 344 1.0E-50
sp|A3N700|HEM3_BURP6 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 668) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q63W73|HEM3_BURPS Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain K96243) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q3JUW3|HEM3_BURP1 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1710b) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A3NSN6|HEM3_BURP0 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1106a) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A1V5U0|HEM3_BURMS Porphobilinogen deaminase OS=Burkholderia mallei (strain SAVP1) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q62LC0|HEM3_BURMA Porphobilinogen deaminase OS=Burkholderia mallei (strain ATCC 23344) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A2SAH5|HEM3_BURM9 Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10229) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A3MLK5|HEM3_BURM7 Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10247) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q8P536|HEM3_XANCP Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hemC PE=3 SV=1 26 341 2.0E-50
sp|Q4UYZ4|HEM3_XANC8 Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hemC PE=3 SV=1 26 341 2.0E-50
sp|Q8RFP5|HEM3_FUSNN Porphobilinogen deaminase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hemC PE=3 SV=1 30 329 6.0E-50
sp|A4IZY4|HEM3_FRATW Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemC PE=3 SV=1 28 343 6.0E-50
sp|Q1D8Z8|HEM3_MYXXD Porphobilinogen deaminase OS=Myxococcus xanthus (strain DK 1622) GN=hemC PE=3 SV=1 26 341 6.0E-50
sp|A7GYU4|HEM3_CAMC5 Porphobilinogen deaminase OS=Campylobacter curvus (strain 525.92) GN=hemC PE=3 SV=1 27 342 1.0E-49
sp|B2SE34|HEM3_FRATM Porphobilinogen deaminase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|Q2A5R3|HEM3_FRATH Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|A7N9H6|HEM3_FRATF Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|C1CYD9|HEM3_DEIDV Porphobilinogen deaminase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=hemC PE=3 SV=1 29 343 1.0E-49
sp|A7ZD37|HEM3_CAMC1 Porphobilinogen deaminase OS=Campylobacter concisus (strain 13826) GN=hemC PE=3 SV=1 28 342 1.0E-49
sp|Q0BP15|HEM3_FRATO Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|Q5NI31|HEM3_FRATT Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|Q14JI3|HEM3_FRAT1 Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|A0Q481|HEM3_FRATN Porphobilinogen deaminase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|B0TW04|HEM3_FRAP2 Porphobilinogen deaminase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hemC PE=3 SV=1 30 342 4.0E-49
sp|B2A1G7|HEM3_NATTJ Porphobilinogen deaminase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hemC PE=3 SV=1 30 341 8.0E-49
sp|Q1INI6|HEM3_KORVE Porphobilinogen deaminase OS=Koribacter versatilis (strain Ellin345) GN=hemC PE=3 SV=1 28 355 2.0E-48
sp|A1AX51|HEM3_RUTMC Porphobilinogen deaminase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hemC PE=3 SV=1 28 342 2.0E-48
sp|A9FDP9|HEM3_SORC5 Porphobilinogen deaminase OS=Sorangium cellulosum (strain So ce56) GN=hemC PE=3 SV=1 26 280 2.0E-48
sp|Q3YSA8|HEM3_EHRCJ Porphobilinogen deaminase OS=Ehrlichia canis (strain Jake) GN=hemC PE=3 SV=1 30 334 2.0E-48
sp|A5UU37|HEM3_ROSS1 Porphobilinogen deaminase OS=Roseiflexus sp. (strain RS-1) GN=hemC PE=3 SV=1 30 281 5.0E-48
sp|A5VSL5|HEM3_BRUO2 Porphobilinogen deaminase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hemC PE=3 SV=1 28 306 6.0E-48
sp|Q8FYI6|HEM3_BRUSU Porphobilinogen deaminase OS=Brucella suis biovar 1 (strain 1330) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|B0CID9|HEM3_BRUSI Porphobilinogen deaminase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|A9M8M2|HEM3_BRUC2 Porphobilinogen deaminase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q8YJB0|HEM3_BRUME Porphobilinogen deaminase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hemC PE=3 SV=2 28 306 7.0E-48
sp|C0RFD1|HEM3_BRUMB Porphobilinogen deaminase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q57B08|HEM3_BRUAB Porphobilinogen deaminase OS=Brucella abortus biovar 1 (strain 9-941) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q2YLM5|HEM3_BRUA2 Porphobilinogen deaminase OS=Brucella abortus (strain 2308) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|B2S842|HEM3_BRUA1 Porphobilinogen deaminase OS=Brucella abortus (strain S19) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q87CC9|HEM3_XYLFT Porphobilinogen deaminase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hemC PE=3 SV=1 27 343 1.0E-47
sp|B2I5K8|HEM3_XYLF2 Porphobilinogen deaminase OS=Xylella fastidiosa (strain M23) GN=hemC PE=3 SV=1 27 343 1.0E-47
sp|A0Q2B1|HEM3_CLONN Porphobilinogen deaminase OS=Clostridium novyi (strain NT) GN=hemC PE=3 SV=1 30 281 1.0E-47
sp|B4RC21|HEM3_PHEZH Porphobilinogen deaminase OS=Phenylobacterium zucineum (strain HLK1) GN=hemC PE=3 SV=1 27 341 3.0E-47
sp|Q7VRM4|HEM3_BLOFL Porphobilinogen deaminase OS=Blochmannia floridanus GN=hemC PE=3 SV=1 25 348 3.0E-47
sp|Q9WX16|HEM31_STRCO Porphobilinogen deaminase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC1 PE=3 SV=1 28 341 3.0E-47
sp|B0U2W8|HEM3_XYLFM Porphobilinogen deaminase OS=Xylella fastidiosa (strain M12) GN=hemC PE=3 SV=1 27 343 3.0E-47
sp|Q9PCX7|HEM3_XYLFA Porphobilinogen deaminase OS=Xylella fastidiosa (strain 9a5c) GN=hemC PE=3 SV=1 27 343 3.0E-47
sp|Q68WR3|HEM3_RICTY Porphobilinogen deaminase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemC PE=3 SV=1 30 286 2.0E-46
sp|A6WXJ2|HEM3_OCHA4 Porphobilinogen deaminase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hemC PE=3 SV=1 27 280 2.0E-46
sp|A8GNR5|HEM3_RICAH Porphobilinogen deaminase OS=Rickettsia akari (strain Hartford) GN=hemC PE=3 SV=1 30 286 2.0E-46
sp|B2FI06|HEM3_STRMK Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain K279a) GN=hemC PE=3 SV=1 30 342 2.0E-46
sp|Q2LQU2|HEM3_SYNAS Porphobilinogen deaminase OS=Syntrophus aciditrophicus (strain SB) GN=hemC PE=3 SV=1 28 349 2.0E-46
sp|Q7M8L2|HEM3_WOLSU Porphobilinogen deaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemC PE=3 SV=1 30 341 5.0E-46
sp|Q1MPL2|HEM3_LAWIP Porphobilinogen deaminase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=hemC PE=3 SV=1 28 345 6.0E-46
sp|B4SJT8|HEM3_STRM5 Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemC PE=3 SV=1 30 342 1.0E-45
sp|Q17W61|HEM3_HELAH Porphobilinogen deaminase OS=Helicobacter acinonychis (strain Sheeba) GN=hemC PE=3 SV=1 30 345 1.0E-45
sp|C4Z552|HEM3_EUBE2 Porphobilinogen deaminase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=hemC PE=3 SV=1 28 325 1.0E-45
sp|Q9ZD77|HEM3_RICPR Porphobilinogen deaminase OS=Rickettsia prowazekii (strain Madrid E) GN=hemC PE=3 SV=1 30 286 1.0E-45
sp|B6JKG8|HEM3_HELP2 Porphobilinogen deaminase OS=Helicobacter pylori (strain P12) GN=hemC PE=3 SV=1 30 342 2.0E-45
sp|P56140|HEM3_HELPY Porphobilinogen deaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemC PE=3 SV=1 30 342 2.0E-45
sp|Q491Z6|HEM3_BLOPB Porphobilinogen deaminase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hemC PE=3 SV=1 27 281 2.0E-45
sp|Q98EI7|HEM3_RHILO Porphobilinogen deaminase OS=Rhizobium loti (strain MAFF303099) GN=hemC PE=3 SV=1 26 328 2.0E-45
sp|B9KGA9|HEM3_CAMLR Porphobilinogen deaminase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=hemC PE=3 SV=1 30 342 3.0E-45
sp|B8DKW2|HEM3_DESVM Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hemC PE=3 SV=1 30 345 3.0E-45
sp|B5ZA04|HEM3_HELPG Porphobilinogen deaminase OS=Helicobacter pylori (strain G27) GN=hemC PE=3 SV=1 30 342 3.0E-45
sp|A8EYJ9|HEM3_RICCK Porphobilinogen deaminase OS=Rickettsia canadensis (strain McKiel) GN=hemC PE=3 SV=1 30 286 6.0E-45
sp|Q82P95|HEM32_STRAW Porphobilinogen deaminase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC2 PE=3 SV=1 21 344 7.0E-45
sp|Q9ZMJ7|HEM3_HELPJ Porphobilinogen deaminase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemC PE=3 SV=1 30 342 1.0E-44
sp|Q4ULA5|HEM3_RICFE Porphobilinogen deaminase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemC PE=3 SV=1 30 286 1.0E-44
sp|Q1QQP5|HEM3_NITHX Porphobilinogen deaminase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hemC PE=3 SV=1 22 308 1.0E-44
sp|A7H4J7|HEM3_CAMJD Porphobilinogen deaminase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemC PE=3 SV=1 30 282 1.0E-44
sp|Q9PHW9|HEM3_CAMJE Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemC PE=3 SV=1 30 282 1.0E-44
sp|Q7VFE9|HEM3_HELHP Porphobilinogen deaminase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hemC PE=3 SV=1 30 342 1.0E-44
sp|A8FKW8|HEM3_CAMJ8 Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemC PE=3 SV=1 30 282 2.0E-44
sp|A6Q7Y4|HEM3_SULNB Porphobilinogen deaminase OS=Sulfurovum sp. (strain NBC37-1) GN=hemC PE=3 SV=1 30 342 2.0E-44
sp|Q5HVM1|HEM3_CAMJR Porphobilinogen deaminase OS=Campylobacter jejuni (strain RM1221) GN=hemC PE=3 SV=1 30 282 3.0E-44
sp|A1VYQ4|HEM3_CAMJJ Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemC PE=3 SV=1 30 282 3.0E-44
sp|Q2GGC7|HEM3_EHRCR Porphobilinogen deaminase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=hemC PE=3 SV=1 30 326 3.0E-44
sp|Q92LH7|HEM3_RHIME Porphobilinogen deaminase OS=Rhizobium meliloti (strain 1021) GN=hemC PE=3 SV=1 28 280 4.0E-44
sp|Q92HR5|HEM3_RICCN Porphobilinogen deaminase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemC PE=3 SV=1 30 286 5.0E-44
sp|C3PNS9|HEM3_RICAE Porphobilinogen deaminase OS=Rickettsia africae (strain ESF-5) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|A8GSI6|HEM3_RICRS Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Sheila Smith) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|B0BY00|HEM3_RICRO Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Iowa) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|C4K265|HEM3_RICPU Porphobilinogen deaminase OS=Rickettsia peacockii (strain Rustic) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|A8F1Y8|HEM3_RICM5 Porphobilinogen deaminase OS=Rickettsia massiliae (strain Mtu5) GN=hemC PE=3 SV=1 30 286 7.0E-44
sp|Q1RJN7|HEM3_RICBR Porphobilinogen deaminase OS=Rickettsia bellii (strain RML369-C) GN=hemC PE=3 SV=1 30 293 9.0E-44
sp|A8GXC8|HEM3_RICB8 Porphobilinogen deaminase OS=Rickettsia bellii (strain OSU 85-389) GN=hemC PE=3 SV=1 30 293 9.0E-44
sp|A9A1A1|HEM3_NITMS Probable porphobilinogen deaminase OS=Nitrosopumilus maritimus (strain SCM1) GN=hemC PE=3 SV=1 28 281 1.0E-43
sp|C6BYB7|HEM3_DESAD Porphobilinogen deaminase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=hemC PE=3 SV=1 28 344 2.0E-43
sp|Q3SVF3|HEM3_NITWN Porphobilinogen deaminase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hemC PE=3 SV=1 29 305 2.0E-43
sp|A1B853|HEM3_PARDP Porphobilinogen deaminase OS=Paracoccus denitrificans (strain Pd 1222) GN=hemC PE=3 SV=1 28 310 2.0E-43
sp|Q6AHF1|HEM3_LEIXX Porphobilinogen deaminase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hemC PE=3 SV=1 28 337 5.0E-43
sp|Q1AUK3|HEM3_RUBXD Porphobilinogen deaminase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hemC PE=3 SV=1 30 349 9.0E-43
sp|A0RNT3|HEM3_CAMFF Porphobilinogen deaminase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemC PE=3 SV=1 28 340 9.0E-43
sp|Q0BX92|HEM3_HYPNA Porphobilinogen deaminase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hemC PE=3 SV=1 28 349 1.0E-42
sp|Q9KY00|HEM32_STRCO Porphobilinogen deaminase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC2 PE=3 SV=1 23 344 2.0E-42
sp|Q82E76|HEM31_STRAW Porphobilinogen deaminase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC1 PE=3 SV=1 28 341 2.0E-42
sp|Q59293|HEM3_CLOJO Porphobilinogen deaminase OS=Clostridium josui GN=hemC PE=3 SV=2 30 280 3.0E-42
sp|Q72AV0|HEM3_DESVH Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hemC PE=3 SV=1 30 347 4.0E-42
sp|Q1GP41|HEM3_SPHAL Porphobilinogen deaminase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hemC PE=3 SV=1 28 307 4.0E-42
sp|Q30Y29|HEM3_DESAG Porphobilinogen deaminase OS=Desulfovibrio alaskensis (strain G20) GN=hemC PE=3 SV=1 30 344 5.0E-42
sp|A1VCX6|HEM3_DESVV Porphobilinogen deaminase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hemC PE=3 SV=1 30 347 6.0E-42
sp|B8I0Q8|HEM3_CLOCE Porphobilinogen deaminase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hemC PE=3 SV=1 30 280 7.0E-42
sp|Q8UC46|HEM3_AGRFC Porphobilinogen deaminase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hemC PE=3 SV=1 28 280 2.0E-41
sp|Q97MU4|HEM3_CLOAB Porphobilinogen deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hemC PE=3 SV=1 30 281 5.0E-41
sp|A5CDH4|HEM3_ORITB Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Boryong) GN=hemC PE=3 SV=1 27 286 6.0E-41
sp|Q6AB05|HEM3_PROAC Porphobilinogen deaminase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hemC PE=3 SV=2 26 281 7.0E-41
sp|B2UXC4|HEM3_CLOBA Porphobilinogen deaminase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hemC PE=3 SV=1 30 334 9.0E-41
sp|Q73SS0|HEM3_MYCPA Porphobilinogen deaminase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hemC PE=3 SV=1 27 352 1.0E-40
sp|Q49808|HEM3_MYCLE Porphobilinogen deaminase OS=Mycobacterium leprae (strain TN) GN=hemC PE=3 SV=2 27 341 1.0E-40
sp|B9DZL6|HEM3_CLOK1 Porphobilinogen deaminase OS=Clostridium kluyveri (strain NBRC 12016) GN=hemC PE=3 SV=1 28 328 2.0E-40
sp|A7GBW3|HEM3_CLOBL Porphobilinogen deaminase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B1KY15|HEM3_CLOBM Porphobilinogen deaminase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B1IHD1|HEM3_CLOBK Porphobilinogen deaminase OS=Clostridium botulinum (strain Okra / Type B1) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|C1FVB9|HEM3_CLOBJ Porphobilinogen deaminase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B2US69|HEM3_HELPS Porphobilinogen deaminase OS=Helicobacter pylori (strain Shi470) GN=hemC PE=3 SV=1 30 342 3.0E-40
sp|Q5YP70|HEM3_NOCFA Porphobilinogen deaminase OS=Nocardia farcinica (strain IFM 10152) GN=hemC PE=3 SV=1 20 349 4.0E-40
sp|A5I0B2|HEM3_CLOBH Porphobilinogen deaminase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hemC PE=3 SV=1 28 285 4.0E-40
sp|A7FSG8|HEM3_CLOB1 Porphobilinogen deaminase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hemC PE=3 SV=1 28 285 4.0E-40
sp|A4T340|HEM3_MYCGI Porphobilinogen deaminase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hemC PE=3 SV=1 27 342 4.0E-40
sp|A0QLI0|HEM3_MYCA1 Porphobilinogen deaminase OS=Mycobacterium avium (strain 104) GN=hemC PE=3 SV=1 27 352 4.0E-40
sp|B2TPD7|HEM3_CLOBB Porphobilinogen deaminase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=hemC PE=3 SV=1 30 334 4.0E-40
sp|C0R2M3|HEM3_WOLWR Porphobilinogen deaminase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hemC PE=3 SV=1 30 332 5.0E-40
sp|A8MGE4|HEM3_ALKOO Porphobilinogen deaminase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hemC PE=3 SV=1 30 280 6.0E-40
sp|A6LSY5|HEM3_CLOB8 Porphobilinogen deaminase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hemC PE=3 SV=1 28 333 2.0E-39
sp|A0PW29|HEM3_MYCUA Porphobilinogen deaminase OS=Mycobacterium ulcerans (strain Agy99) GN=hemC PE=3 SV=1 27 341 2.0E-39
sp|P9WMP3|HEM3_MYCTU Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hemC PE=1 SV=1 27 341 3.0E-39
sp|P9WMP2|HEM3_MYCTO Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|A5TZP0|HEM3_MYCTA Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|C1AKJ0|HEM3_MYCBT Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|A1KFY6|HEM3_MYCBP Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|P64337|HEM3_MYCBO Porphobilinogen deaminase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|C3L2Z3|HEM3_CLOB6 Porphobilinogen deaminase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hemC PE=3 SV=1 28 285 3.0E-39
sp|Q0W5T2|HEM3_METAR Probable porphobilinogen deaminase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hemC PE=3 SV=1 28 282 3.0E-39
sp|A8ZWG5|HEM3_DESOH Porphobilinogen deaminase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hemC PE=3 SV=1 30 279 4.0E-39
sp|B0T287|HEM3_CAUSK Porphobilinogen deaminase OS=Caulobacter sp. (strain K31) GN=hemC PE=3 SV=1 28 281 4.0E-39
sp|Q1CUR5|HEM3_HELPH Porphobilinogen deaminase OS=Helicobacter pylori (strain HPAG1) GN=hemC PE=3 SV=1 30 342 5.0E-39
sp|Q9ABZ8|HEM3_CAUCR Porphobilinogen deaminase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hemC PE=3 SV=1 28 281 7.0E-39
sp|B8GXG1|HEM3_CAUCN Porphobilinogen deaminase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hemC PE=3 SV=1 28 281 7.0E-39
sp|B2HRJ2|HEM3_MYCMM Porphobilinogen deaminase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hemC PE=3 SV=1 27 341 7.0E-39
sp|Q8XKG4|HEM3_CLOPE Porphobilinogen deaminase OS=Clostridium perfringens (strain 13 / Type A) GN=hemC PE=3 SV=1 30 344 3.0E-38
sp|A1T3D3|HEM3_MYCVP Porphobilinogen deaminase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hemC PE=3 SV=1 27 342 3.0E-38
sp|Q0TQG4|HEM3_CLOP1 Porphobilinogen deaminase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=hemC PE=3 SV=1 30 281 4.0E-38
sp|A3DIF0|HEM3_CLOTH Porphobilinogen deaminase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hemC PE=3 SV=1 30 279 4.0E-38
sp|Q11XT5|HEM3_CYTH3 Porphobilinogen deaminase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hemC PE=3 SV=1 30 345 9.0E-38
sp|Q57989|HEM3_METJA Probable porphobilinogen deaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hemC PE=3 SV=1 30 332 1.0E-37
sp|B1MHI5|HEM3_MYCA9 Porphobilinogen deaminase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hemC PE=3 SV=1 27 341 2.0E-37
sp|O29026|HEM3_ARCFU Probable porphobilinogen deaminase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hemC PE=3 SV=1 30 334 2.0E-37
sp|Q0ST16|HEM3_CLOPS Porphobilinogen deaminase OS=Clostridium perfringens (strain SM101 / Type A) GN=hemC PE=3 SV=1 30 281 2.0E-37
sp|A8MDU3|HEM3_CALMQ Probable porphobilinogen deaminase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hemC PE=3 SV=1 27 281 3.0E-36
sp|Q6L2G8|HEM3_PICTO Probable porphobilinogen deaminase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemC PE=3 SV=1 30 295 4.0E-36
sp|Q7UPN0|HEM3_RHOBA Porphobilinogen deaminase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemC PE=3 SV=1 23 344 6.0E-36
sp|B3CUP9|HEM3_ORITI Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Ikeda) GN=hemC PE=3 SV=1 27 281 7.0E-36
sp|C5CB88|HEM3_MICLC Porphobilinogen deaminase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hemC PE=3 SV=1 28 340 8.0E-36
sp|Q12WM8|HEM3_METBU Probable porphobilinogen deaminase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hemC PE=3 SV=1 30 281 9.0E-36
sp|A4QB59|HEM3_CORGB Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain R) GN=hemC PE=3 SV=1 28 341 1.0E-35
sp|Q8NT90|HEM3_CORGL Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hemC PE=3 SV=1 28 341 2.0E-35
sp|P30527|HEM3_YERIN Porphobilinogen deaminase (Fragment) OS=Yersinia intermedia GN=hemC PE=3 SV=1 27 213 5.0E-35
sp|Q8FSF7|HEM3_COREF Porphobilinogen deaminase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hemC PE=3 SV=1 28 341 1.0E-34
sp|Q8TT56|HEM3_METAC Probable porphobilinogen deaminase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hemC PE=3 SV=1 30 329 2.0E-34
sp|Q46CH0|HEM3_METBF Probable porphobilinogen deaminase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hemC PE=3 SV=1 30 307 2.0E-34
sp|A8AAB4|HEM3_IGNH4 Probable porphobilinogen deaminase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hemC PE=3 SV=1 28 329 3.0E-34
sp|A4WN24|HEM3_PYRAR Probable porphobilinogen deaminase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=hemC PE=3 SV=1 30 281 8.0E-34
sp|Q8PW57|HEM3_METMA Probable porphobilinogen deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hemC PE=3 SV=1 30 310 2.0E-33
sp|A2BL26|HEM3_HYPBU Probable porphobilinogen deaminase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=hemC PE=3 SV=1 28 314 5.0E-33
sp|Q8ZYW7|HEM3_PYRAE Probable porphobilinogen deaminase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hemC PE=3 SV=1 28 329 6.0E-33
sp|A1RQK2|HEM3_PYRIL Probable porphobilinogen deaminase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=hemC PE=3 SV=1 28 308 1.0E-32
sp|Q6NJK0|HEM3_CORDI Porphobilinogen deaminase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hemC PE=3 SV=1 28 341 2.0E-32
sp|C3PKG2|HEM3_CORA7 Porphobilinogen deaminase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hemC PE=3 SV=1 27 343 6.0E-32
sp|O26960|HEM3_METTH Probable porphobilinogen deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hemC PE=3 SV=1 31 282 2.0E-31
sp|Q97B26|HEM3_THEVO Probable porphobilinogen deaminase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemC PE=3 SV=1 30 306 3.0E-31
sp|A4XK06|HEM3_CALS8 Porphobilinogen deaminase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hemC PE=3 SV=1 30 282 5.0E-31
sp|Q8TXC8|HEM3_METKA Probable porphobilinogen deaminase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hemC PE=3 SV=2 25 282 1.0E-30
sp|B1YDP0|HEM3_PYRNV Probable porphobilinogen deaminase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=hemC PE=3 SV=1 28 281 1.0E-29
sp|A3MWV7|HEM3_PYRCJ Probable porphobilinogen deaminase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hemC PE=3 SV=1 28 281 1.0E-28
sp|Q9HKM5|HEM3_THEAC Probable porphobilinogen deaminase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemC PE=3 SV=1 30 310 2.0E-28
sp|A4YD92|HEM3_METS5 Probable porphobilinogen deaminase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hemC PE=3 SV=1 30 282 2.0E-25
sp|Q980U4|HEM3_SULSO Probable porphobilinogen deaminase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hemC PE=3 SV=1 30 282 2.0E-25
sp|C3NF70|HEM3_SULIN Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MYD9|HEM3_SULIM Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MZR8|HEM3_SULIA Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.27) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MJ21|HEM3_SULIL Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hemC PE=3 SV=1 30 282 5.0E-25
sp|C4KIZ9|HEM3_SULIK Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hemC PE=3 SV=1 30 282 5.0E-25
sp|C3N841|HEM3_SULIY Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hemC PE=3 SV=1 30 282 6.0E-25
sp|Q976H1|HEM3_SULTO Probable porphobilinogen deaminase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hemC PE=3 SV=1 30 336 1.0E-23
sp|Q9PK95|HEM3_CHLMU Probable porphobilinogen deaminase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=hemC PE=3 SV=1 30 209 1.0E-21
sp|Q9HMY5|HEM3_HALSA Probable porphobilinogen deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hemC PE=3 SV=1 28 188 8.0E-21
sp|Q9Y9J0|HEM3_AERPE Probable porphobilinogen deaminase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hemC PE=3 SV=2 30 280 8.0E-20
sp|O84301|HEM3_CHLTR Probable porphobilinogen deaminase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=hemC PE=3 SV=1 30 209 1.0E-18
sp|Q9Z9C9|HEM3_CHLPN Probable porphobilinogen deaminase OS=Chlamydia pneumoniae GN=hemC PE=3 SV=1 30 214 8.0E-17
sp|P40129|HEM3_DICCH Porphobilinogen deaminase (Fragment) OS=Dickeya chrysanthemi GN=hemC PE=3 SV=1 26 111 3.0E-09
sp|Q9HMY5|HEM3_HALSA Probable porphobilinogen deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hemC PE=3 SV=1 181 342 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0033014 tetrapyrrole biosynthetic process Yes
GO:0004418 hydroxymethylbilane synthase activity Yes
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4903 0.3087 0.0119 0.1689 0.5935 0.3571 0.3806 0.2827 0.1818 0.1537

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3252
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3911
Ophiocordyceps australis map64 (Brazil) OphauB2|6838
Ophiocordyceps camponoti-floridani Ophcf2|01623
Ophiocordyceps camponoti-rufipedis Ophun1|2905
Ophiocordyceps kimflemingae Ophio5|1760
Ophiocordyceps subramaniannii Hirsu2|5911 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5911
MAEAQPPTEEAASRPGDVAGGGSAATVFNVGTRKSPLALAQTDIIVSALQALFPTSSFPVHGMTTTGDRDQHTAL
YNFGGKGLWTSQLEERLVRGELDLVVHSLKDMPTTLPAGCVLGCVTNREDPRDSLVVSRRVARDQGWRTLADLPP
GSVVGTSSVRRIAQLARRYPGLRFKDVRGNIQTRLQKLDDDPEMAAIVLAAAGLQRMKLGHRISQYLDGSDGGAG
VLHAVGQGALGVECRAGDERVLAALRRLEHPDTALACLAERSLMRALEGGCSVPIGVETSWPRPGRLRLRATVVS
AAGTDAVDADLADDVATHQAADELGRRVALDLLGRGADKILEAINAARPAPAAAPDKQ*
Coding >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA
Transcript >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA
Gene >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail