Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5911
Gene name
LocationContig_3:3577..4654
Strand-
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain 7.5E-77 29 246
PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain 5.7E-16 260 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW51|HEM3_NEUCR Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 29 353 1.0E-111
sp|Q6C097|HEM3_YARLI Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 27 345 8.0E-99
sp|O94048|HEM3_CANAL Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1 30 352 4.0E-92
sp|Q6BM23|HEM3_DEBHA Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 30 358 5.0E-88
sp|Q8DIE4|HEM3_THEEB Porphobilinogen deaminase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemC PE=3 SV=1 30 349 7.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW51|HEM3_NEUCR Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 29 353 1.0E-111
sp|Q6C097|HEM3_YARLI Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 27 345 8.0E-99
sp|O94048|HEM3_CANAL Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1 30 352 4.0E-92
sp|Q6BM23|HEM3_DEBHA Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 30 358 5.0E-88
sp|Q8DIE4|HEM3_THEEB Porphobilinogen deaminase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemC PE=3 SV=1 30 349 7.0E-88
sp|Q6FNR4|HEM3_CANGA Porphobilinogen deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM3 PE=3 SV=1 28 348 1.0E-87
sp|Q75DY0|HEM3_ASHGO Porphobilinogen deaminase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM3 PE=3 SV=1 28 345 3.0E-86
sp|P28789|HEM3_YEAST Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM3 PE=1 SV=1 28 348 5.0E-86
sp|Q8YVU6|HEM3_NOSS1 Porphobilinogen deaminase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemC PE=3 SV=2 23 346 2.0E-82
sp|P73660|HEM3_SYNY3 Porphobilinogen deaminase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemC PE=3 SV=1 23 346 2.0E-82
sp|Q31PM2|HEM3_SYNE7 Porphobilinogen deaminase OS=Synechococcus elongatus (strain PCC 7942) GN=hemC PE=3 SV=1 23 303 6.0E-82
sp|A2C0V4|HEM3_PROM1 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL1A) GN=hemC PE=3 SV=1 28 344 1.0E-81
sp|Q46GS7|HEM3_PROMT Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL2A) GN=hemC PE=3 SV=1 28 344 8.0E-81
sp|Q2KIN5|HEM3_BOVIN Porphobilinogen deaminase OS=Bos taurus GN=HMBS PE=2 SV=1 18 343 9.0E-81
sp|P22907|HEM3_MOUSE Porphobilinogen deaminase OS=Mus musculus GN=Hmbs PE=1 SV=2 21 343 1.0E-80
sp|P08397|HEM3_HUMAN Porphobilinogen deaminase OS=Homo sapiens GN=HMBS PE=1 SV=2 18 342 1.0E-80
sp|A5GSE0|HEM3_SYNR3 Porphobilinogen deaminase OS=Synechococcus sp. (strain RCC307) GN=hemC PE=3 SV=1 25 349 5.0E-80
sp|Q6CT60|HEM3_KLULA Porphobilinogen deaminase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEM3 PE=3 SV=1 30 345 8.0E-80
sp|Q7VD89|HEM3_PROMA Porphobilinogen deaminase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hemC PE=3 SV=1 30 344 8.0E-80
sp|P19356|HEM3_RAT Porphobilinogen deaminase OS=Rattus norvegicus GN=Hmbs PE=1 SV=2 21 343 8.0E-80
sp|A2BVF7|HEM3_PROM5 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemC PE=3 SV=1 28 344 3.0E-79
sp|Q31C38|HEM3_PROM9 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemC PE=3 SV=1 28 344 2.0E-78
sp|A8G3L1|HEM3_PROM2 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemC PE=3 SV=1 28 344 2.0E-78
sp|Q09899|HEM3_SCHPO Porphobilinogen deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem3 PE=1 SV=2 24 342 3.0E-78
sp|Q7V2I1|HEM3_PROMP Porphobilinogen deaminase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemC PE=3 SV=1 28 344 4.0E-78
sp|Q3ALS9|HEM3_SYNSC Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9605) GN=hemC PE=3 SV=1 24 349 4.0E-77
sp|Q7V697|HEM3_PROMM Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemC PE=3 SV=1 26 349 4.0E-77
sp|A2C7L8|HEM3_PROM3 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9303) GN=hemC PE=3 SV=1 26 349 1.0E-76
sp|A2BPX7|HEM3_PROMS Porphobilinogen deaminase OS=Prochlorococcus marinus (strain AS9601) GN=hemC PE=3 SV=1 28 344 2.0E-76
sp|Q7NGF7|HEM3_GLOVI Porphobilinogen deaminase OS=Gloeobacter violaceus (strain PCC 7421) GN=hemC PE=3 SV=1 30 355 1.0E-75
sp|A3PBM0|HEM3_PROM0 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemC PE=3 SV=1 28 344 1.0E-75
sp|Q7U5C2|HEM3_SYNPX Porphobilinogen deaminase OS=Synechococcus sp. (strain WH8102) GN=hemC PE=3 SV=1 24 349 2.0E-75
sp|A9BEB6|HEM3_PROM4 Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9211) GN=hemC PE=3 SV=1 28 344 9.0E-75
sp|Q0I8I3|HEM3_SYNS3 Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9311) GN=hemC PE=3 SV=1 28 344 2.0E-74
sp|Q54P93|HEM3_DICDI Porphobilinogen deaminase OS=Dictyostelium discoideum GN=hemC PE=3 SV=1 30 341 5.0E-73
sp|Q3AWQ4|HEM3_SYNS9 Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9902) GN=hemC PE=3 SV=1 24 349 6.0E-73
sp|C1D679|HEM3_LARHH Porphobilinogen deaminase OS=Laribacter hongkongensis (strain HLHK9) GN=hemC PE=3 SV=1 30 347 3.0E-69
sp|A1AUE7|HEM3_PELPD Porphobilinogen deaminase OS=Pelobacter propionicus (strain DSM 2379) GN=hemC PE=3 SV=1 28 344 4.0E-69
sp|Q602K3|HEM3_METCA Porphobilinogen deaminase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hemC PE=3 SV=2 24 346 1.0E-67
sp|A6VL87|HEM3_ACTSZ Porphobilinogen deaminase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=hemC PE=3 SV=1 27 344 2.0E-67
sp|Q3A009|HEM3_PELCD Porphobilinogen deaminase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hemC PE=3 SV=1 24 351 2.0E-67
sp|Q65VX7|HEM3_MANSM Porphobilinogen deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hemC PE=3 SV=1 28 344 1.0E-66
sp|Q7P207|HEM3_CHRVO Porphobilinogen deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemC PE=3 SV=2 30 346 2.0E-66
sp|A4J6H7|HEM3_DESRM Porphobilinogen deaminase OS=Desulfotomaculum reducens (strain MI-1) GN=hemC PE=3 SV=1 28 346 4.0E-66
sp|B1I4L8|HEM3_DESAP Porphobilinogen deaminase OS=Desulforudis audaxviator (strain MP104C) GN=hemC PE=3 SV=1 30 346 6.0E-66
sp|C0ZAH1|HEM3_BREBN Porphobilinogen deaminase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemC PE=3 SV=1 28 344 9.0E-66
sp|Q3SFT5|HEM3_THIDA Porphobilinogen deaminase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemC PE=3 SV=1 28 346 3.0E-65
sp|B3EIN1|HEM3_CHLL2 Porphobilinogen deaminase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemC PE=3 SV=1 30 348 4.0E-65
sp|Q48AW8|HEM3_COLP3 Porphobilinogen deaminase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hemC PE=3 SV=1 26 344 5.0E-65
sp|A1WVT9|HEM3_HALHL Porphobilinogen deaminase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hemC PE=3 SV=1 24 344 9.0E-65
sp|Q82WS2|HEM3_NITEU Porphobilinogen deaminase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemC PE=3 SV=1 30 344 1.0E-64
sp|Q65GK1|HEM3_BACLD Porphobilinogen deaminase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hemC PE=3 SV=1 30 303 1.0E-64
sp|P16616|HEM3_BACSU Porphobilinogen deaminase OS=Bacillus subtilis (strain 168) GN=hemC PE=3 SV=3 28 345 2.0E-64
sp|Q5KWK6|HEM3_GEOKA Porphobilinogen deaminase OS=Geobacillus kaustophilus (strain HTA426) GN=hemC PE=3 SV=1 30 345 2.0E-64
sp|Q5WEP5|HEM3_BACSK Porphobilinogen deaminase OS=Bacillus clausii (strain KSM-K16) GN=hemC PE=3 SV=1 30 346 2.0E-64
sp|Q088L3|HEM3_SHEFN Porphobilinogen deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=hemC PE=3 SV=1 26 347 4.0E-64
sp|Q9K8G0|HEM3_BACHD Porphobilinogen deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemC PE=3 SV=1 30 345 5.0E-64
sp|B1KQC6|HEM3_SHEWM Porphobilinogen deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hemC PE=3 SV=1 26 344 6.0E-64
sp|A0LN73|HEM3_SYNFM Porphobilinogen deaminase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hemC PE=3 SV=1 27 347 7.0E-64
sp|Q8KCJ4|HEM3_CHLTE Porphobilinogen deaminase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemC PE=3 SV=1 30 348 8.0E-64
sp|Q3AQF5|HEM3_CHLCH Porphobilinogen deaminase OS=Chlorobium chlorochromatii (strain CaD3) GN=hemC PE=3 SV=1 30 344 1.0E-63
sp|A6TJD5|HEM3_ALKMQ Porphobilinogen deaminase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hemC PE=3 SV=1 28 345 2.0E-63
sp|B9DNE1|HEM3_STACT Porphobilinogen deaminase OS=Staphylococcus carnosus (strain TM300) GN=hemC PE=3 SV=1 30 345 2.0E-63
sp|B0TJ54|HEM3_SHEHH Porphobilinogen deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=hemC PE=3 SV=1 26 346 4.0E-63
sp|A1BHD6|HEM3_CHLPD Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hemC PE=3 SV=1 30 348 7.0E-63
sp|A1RPD7|HEM3_SHESW Porphobilinogen deaminase OS=Shewanella sp. (strain W3-18-1) GN=hemC PE=3 SV=1 28 346 8.0E-63
sp|A4YBG2|HEM3_SHEPC Porphobilinogen deaminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=hemC PE=3 SV=1 28 346 8.0E-63
sp|B2JEN9|HEM3_BURP8 Porphobilinogen deaminase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemC PE=3 SV=1 30 354 8.0E-63
sp|Q0HQI7|HEM3_SHESR Porphobilinogen deaminase OS=Shewanella sp. (strain MR-7) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q0HN99|HEM3_SHESM Porphobilinogen deaminase OS=Shewanella sp. (strain MR-4) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|A0KS60|HEM3_SHESA Porphobilinogen deaminase OS=Shewanella sp. (strain ANA-3) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q8E9H0|HEM3_SHEON Porphobilinogen deaminase OS=Shewanella oneidensis (strain MR-1) GN=hemC PE=3 SV=1 28 346 9.0E-63
sp|Q9CK24|HEM3_PASMU Porphobilinogen deaminase OS=Pasteurella multocida (strain Pm70) GN=hemC PE=3 SV=2 28 346 1.0E-62
sp|A8GZG4|HEM3_SHEPA Porphobilinogen deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hemC PE=3 SV=1 26 346 2.0E-62
sp|A8G0W4|HEM3_SHESH Porphobilinogen deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=hemC PE=3 SV=1 26 344 3.0E-62
sp|Q39QM7|HEM3_GEOMG Porphobilinogen deaminase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hemC PE=3 SV=1 28 341 4.0E-62
sp|A4SFJ8|HEM3_CHLPM Porphobilinogen deaminase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hemC PE=3 SV=1 30 344 5.0E-62
sp|A7Z7A5|HEM3_BACMF Porphobilinogen deaminase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hemC PE=3 SV=1 28 345 8.0E-62
sp|Q5QUS3|HEM3_IDILO Porphobilinogen deaminase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemC PE=3 SV=1 30 344 9.0E-62
sp|B7VMD9|HEM3_VIBTL Porphobilinogen deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=hemC PE=3 SV=1 28 346 9.0E-62
sp|Q87KI9|HEM3_VIBPA Porphobilinogen deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hemC PE=3 SV=1 23 346 9.0E-62
sp|B8E879|HEM3_SHEB2 Porphobilinogen deaminase OS=Shewanella baltica (strain OS223) GN=hemC PE=3 SV=1 28 346 1.0E-61
sp|B0UWZ8|HEM3_HISS2 Porphobilinogen deaminase OS=Histophilus somni (strain 2336) GN=hemC PE=3 SV=1 23 344 1.0E-61
sp|Q0I178|HEM3_HAES1 Porphobilinogen deaminase OS=Haemophilus somnus (strain 129Pt) GN=hemC PE=3 SV=1 23 344 1.0E-61
sp|A6WTG0|HEM3_SHEB8 Porphobilinogen deaminase OS=Shewanella baltica (strain OS185) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|A3D9Q4|HEM3_SHEB5 Porphobilinogen deaminase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|Q3B2Z5|HEM3_CHLL7 Porphobilinogen deaminase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hemC PE=3 SV=1 30 347 2.0E-61
sp|A9L5G0|HEM3_SHEB9 Porphobilinogen deaminase OS=Shewanella baltica (strain OS195) GN=hemC PE=3 SV=1 28 346 2.0E-61
sp|C6DHC2|HEM3_PECCP Porphobilinogen deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hemC PE=3 SV=1 25 344 3.0E-61
sp|Q6CZG3|HEM3_PECAS Porphobilinogen deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hemC PE=3 SV=1 25 344 4.0E-61
sp|Q2RJ26|HEM3_MOOTA Porphobilinogen deaminase OS=Moorella thermoacetica (strain ATCC 39073) GN=hemC PE=3 SV=1 28 346 5.0E-61
sp|B3QWI1|HEM3_CHLT3 Porphobilinogen deaminase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hemC PE=3 SV=1 30 341 5.0E-61
sp|B4SFI2|HEM3_PELPB Porphobilinogen deaminase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hemC PE=3 SV=1 30 348 6.0E-61
sp|C5D5K7|HEM3_GEOSW Porphobilinogen deaminase OS=Geobacillus sp. (strain WCH70) GN=hemC PE=3 SV=1 30 345 9.0E-61
sp|Q7MQC7|HEM3_VIBVY Porphobilinogen deaminase OS=Vibrio vulnificus (strain YJ016) GN=hemC PE=3 SV=1 23 341 9.0E-61
sp|Q8DD85|HEM3_VIBVU Porphobilinogen deaminase OS=Vibrio vulnificus (strain CMCP6) GN=hemC PE=3 SV=1 23 341 9.0E-61
sp|A8FFV2|HEM3_BACP2 Porphobilinogen deaminase OS=Bacillus pumilus (strain SAFR-032) GN=hemC PE=3 SV=1 28 303 1.0E-60
sp|A7MXU9|HEM3_VIBCB Porphobilinogen deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hemC PE=3 SV=1 23 346 1.0E-60
sp|A9MJ10|HEM3_SALAR Porphobilinogen deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemC PE=3 SV=1 26 350 1.0E-60
sp|A5D3L5|HEM3_PELTS Porphobilinogen deaminase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hemC PE=3 SV=1 30 342 1.0E-60
sp|A5GCW2|HEM3_GEOUR Porphobilinogen deaminase OS=Geobacter uraniireducens (strain Rf4) GN=hemC PE=3 SV=1 24 341 2.0E-60
sp|B5FF97|HEM3_VIBFM Porphobilinogen deaminase OS=Vibrio fischeri (strain MJ11) GN=hemC PE=3 SV=1 30 346 2.0E-60
sp|Q5E8T5|HEM3_VIBF1 Porphobilinogen deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hemC PE=3 SV=1 30 346 2.0E-60
sp|Q7MYN1|HEM3_PHOLL Porphobilinogen deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hemC PE=3 SV=1 24 350 2.0E-60
sp|Q9JVS4|HEM3_NEIMA Porphobilinogen deaminase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hemC PE=3 SV=1 30 344 2.0E-60
sp|Q9K0P6|HEM3_NEIMB Porphobilinogen deaminase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hemC PE=3 SV=1 30 344 3.0E-60
sp|B9E743|HEM3_MACCJ Porphobilinogen deaminase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hemC PE=3 SV=1 30 345 3.0E-60
sp|Q4L709|HEM3_STAHJ Porphobilinogen deaminase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemC PE=3 SV=1 30 348 4.0E-60
sp|Q747I1|HEM3_GEOSL Porphobilinogen deaminase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hemC PE=3 SV=1 28 341 5.0E-60
sp|B4F1X3|HEM3_PROMH Porphobilinogen deaminase OS=Proteus mirabilis (strain HI4320) GN=hemC PE=3 SV=1 24 350 6.0E-60
sp|B7LU53|HEM3_ESCF3 Porphobilinogen deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hemC PE=3 SV=1 26 341 7.0E-60
sp|B1J1V2|HEM3_PSEPW Porphobilinogen deaminase OS=Pseudomonas putida (strain W619) GN=hemC PE=3 SV=1 28 344 1.0E-59
sp|P28464|HEM3_CHLP8 Porphobilinogen deaminase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemC PE=3 SV=4 30 344 1.0E-59
sp|C4K4E3|HEM3_HAMD5 Porphobilinogen deaminase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=hemC PE=3 SV=1 24 345 2.0E-59
sp|B6EPK1|HEM3_ALISL Porphobilinogen deaminase OS=Aliivibrio salmonicida (strain LFI1238) GN=hemC PE=3 SV=1 30 346 2.0E-59
sp|Q02EA3|HEM3_PSEAB Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hemC PE=3 SV=1 28 344 2.0E-59
sp|A4TRA8|HEM3_YERPP Porphobilinogen deaminase OS=Yersinia pestis (strain Pestoides F) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|Q1CNI3|HEM3_YERPN Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|P46355|HEM3_YERPE Porphobilinogen deaminase OS=Yersinia pestis GN=hemC PE=3 SV=2 27 350 2.0E-59
sp|Q1CBN1|HEM3_YERPA Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|A7FD67|HEM3_YERP3 Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hemC PE=3 SV=1 27 350 2.0E-59
sp|Q9KVM1|HEM3_VIBCH Porphobilinogen deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hemC PE=3 SV=2 26 342 2.0E-59
sp|B2T1D1|HEM3_BURPP Porphobilinogen deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemC PE=3 SV=1 30 354 2.0E-59
sp|B8GSU8|HEM3_THISH Porphobilinogen deaminase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemC PE=3 SV=1 28 341 3.0E-59
sp|Q60169|HEM3_PSEAE Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hemC PE=3 SV=2 28 344 4.0E-59
sp|B7V5F0|HEM3_PSEA8 Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain LESB58) GN=hemC PE=3 SV=1 28 344 4.0E-59
sp|Q1I316|HEM3_PSEE4 Porphobilinogen deaminase OS=Pseudomonas entomophila (strain L48) GN=hemC PE=3 SV=1 28 344 4.0E-59
sp|B8DHJ2|HEM3_LISMH Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hemC PE=3 SV=1 30 344 4.0E-59
sp|P0A1Q8|HEM3_SALTY Porphobilinogen deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|P0A1Q9|HEM3_SALTI Porphobilinogen deaminase OS=Salmonella typhi GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B4TNV3|HEM3_SALSV Porphobilinogen deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B5BIU8|HEM3_SALPK Porphobilinogen deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|C0Q3B3|HEM3_SALPC Porphobilinogen deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|Q5PKL7|HEM3_SALPA Porphobilinogen deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|B5FN93|HEM3_SALDC Porphobilinogen deaminase OS=Salmonella dublin (strain CT_02021853) GN=hemC PE=3 SV=1 26 350 5.0E-59
sp|Q6GG35|HEM3_STAAR Porphobilinogen deaminase OS=Staphylococcus aureus (strain MRSA252) GN=hemC PE=3 SV=1 30 345 5.0E-59
sp|Q2YTB9|HEM3_STAAB Porphobilinogen deaminase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hemC PE=3 SV=1 30 345 5.0E-59
sp|Q0AZ43|HEM3_SYNWW Porphobilinogen deaminase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hemC PE=3 SV=1 28 341 6.0E-59
sp|A4IRG5|HEM3_GEOTN Porphobilinogen deaminase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemC PE=3 SV=1 30 345 6.0E-59
sp|Q1GXA1|HEM3_METFK Porphobilinogen deaminase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemC PE=3 SV=1 23 344 7.0E-59
sp|Q66G00|HEM3_YERPS Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hemC PE=3 SV=1 27 350 8.0E-59
sp|B2K065|HEM3_YERPB Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hemC PE=3 SV=1 27 350 8.0E-59
sp|Q49YA2|HEM3_STAS1 Porphobilinogen deaminase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hemC PE=3 SV=1 30 345 9.0E-59
sp|B9M416|HEM3_GEODF Porphobilinogen deaminase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hemC PE=3 SV=1 28 341 9.0E-59
sp|C6DYY8|HEM3_GEOSM Porphobilinogen deaminase OS=Geobacter sp. (strain M21) GN=hemC PE=3 SV=1 28 341 1.0E-58
sp|B1JPE6|HEM3_YERPY Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hemC PE=3 SV=1 27 350 1.0E-58
sp|A8Z2J1|HEM3_STAAT Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A6QHK4|HEM3_STAAE Porphobilinogen deaminase OS=Staphylococcus aureus (strain Newman) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q5HFA2|HEM3_STAAC Porphobilinogen deaminase OS=Staphylococcus aureus (strain COL) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|O34090|HEM3_STAA8 Porphobilinogen deaminase OS=Staphylococcus aureus (strain NCTC 8325) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q2FG66|HEM3_STAA3 Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|P64341|HEM3_STAAN Porphobilinogen deaminase OS=Staphylococcus aureus (strain N315) GN=hemC PE=1 SV=1 30 345 1.0E-58
sp|P64340|HEM3_STAAM Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A5ITJ5|HEM3_STAA9 Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH9) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A6U2D8|HEM3_STAA2 Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH1) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|A7X391|HEM3_STAA1 Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hemC PE=3 SV=1 30 345 1.0E-58
sp|Q8CNY8|HEM3_STAES Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemC PE=3 SV=1 30 348 1.0E-58
sp|Q5HNN3|HEM3_STAEQ Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemC PE=3 SV=1 30 348 1.0E-58
sp|A1T0R0|HEM3_PSYIN Porphobilinogen deaminase OS=Psychromonas ingrahamii (strain 37) GN=hemC PE=3 SV=1 25 341 2.0E-58
sp|B0KH05|HEM3_PSEPG Porphobilinogen deaminase OS=Pseudomonas putida (strain GB-1) GN=hemC PE=3 SV=1 28 344 2.0E-58
sp|Q8NW74|HEM3_STAAW Porphobilinogen deaminase OS=Staphylococcus aureus (strain MW2) GN=hemC PE=3 SV=1 30 345 2.0E-58
sp|Q6G8Q5|HEM3_STAAS Porphobilinogen deaminase OS=Staphylococcus aureus (strain MSSA476) GN=hemC PE=3 SV=1 30 345 2.0E-58
sp|Q59684|HEM3_PROMI Porphobilinogen deaminase OS=Proteus mirabilis GN=hemC PE=3 SV=1 26 344 2.0E-58
sp|A6TGI8|HEM3_KLEP7 Porphobilinogen deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hemC PE=3 SV=1 27 344 3.0E-58
sp|B5XYL1|HEM3_KLEP3 Porphobilinogen deaminase OS=Klebsiella pneumoniae (strain 342) GN=hemC PE=3 SV=1 27 344 3.0E-58
sp|A9R8K0|HEM3_YERPG Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hemC PE=3 SV=1 27 350 3.0E-58
sp|Q3K4T0|HEM3_PSEPF Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hemC PE=3 SV=1 28 344 4.0E-58
sp|A7MQJ1|HEM3_CROS8 Porphobilinogen deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemC PE=3 SV=1 26 341 4.0E-58
sp|Q71ZB2|HEM3_LISMF Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemC PE=3 SV=1 30 344 4.0E-58
sp|C1KVK3|HEM3_LISMC Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hemC PE=3 SV=1 30 344 4.0E-58
sp|Q0VM28|HEM3_ALCBS Porphobilinogen deaminase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hemC PE=3 SV=1 27 346 5.0E-58
sp|Q15Z15|HEM3_PSEA6 Porphobilinogen deaminase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hemC PE=3 SV=1 27 344 6.0E-58
sp|A8G848|HEM3_SERP5 Porphobilinogen deaminase OS=Serratia proteamaculans (strain 568) GN=hemC PE=3 SV=1 27 349 9.0E-58
sp|A7GTE5|HEM3_BACCN Porphobilinogen deaminase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hemC PE=3 SV=1 30 345 1.0E-57
sp|B6I4E0|HEM3_ECOSE Porphobilinogen deaminase OS=Escherichia coli (strain SE11) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|B7M603|HEM3_ECO8A Porphobilinogen deaminase OS=Escherichia coli O8 (strain IAI1) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|B7L959|HEM3_ECO55 Porphobilinogen deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|Q6FFA9|HEM3_ACIAD Porphobilinogen deaminase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hemC PE=3 SV=1 28 341 1.0E-57
sp|P06983|HEM3_ECOLI Porphobilinogen deaminase OS=Escherichia coli (strain K12) GN=hemC PE=1 SV=2 26 350 1.0E-57
sp|B1XAH2|HEM3_ECODH Porphobilinogen deaminase OS=Escherichia coli (strain K12 / DH10B) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|C4ZZ69|HEM3_ECOBW Porphobilinogen deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hemC PE=3 SV=1 26 350 1.0E-57
sp|A4WG12|HEM3_ENT38 Porphobilinogen deaminase OS=Enterobacter sp. (strain 638) GN=hemC PE=3 SV=1 26 349 1.0E-57
sp|B7NFA7|HEM3_ECOLU Porphobilinogen deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hemC PE=3 SV=1 26 350 2.0E-57
sp|Q8XAP3|HEM3_ECO57 Porphobilinogen deaminase OS=Escherichia coli O157:H7 GN=hemC PE=3 SV=2 26 350 2.0E-57
sp|Q2SQ70|HEM3_HAHCH Porphobilinogen deaminase OS=Hahella chejuensis (strain KCTC 2396) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|Q24VC8|HEM3_DESHY Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain Y51) GN=hemC PE=3 SV=1 29 344 2.0E-57
sp|B8G2M2|HEM3_DESHD Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hemC PE=3 SV=1 29 344 2.0E-57
sp|B7NTE0|HEM3_ECO7I Porphobilinogen deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hemC PE=3 SV=1 26 350 2.0E-57
sp|B3EPK0|HEM3_CHLPB Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain BS1) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|Q500N6|HEM3_PSEU2 Porphobilinogen deaminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hemC PE=3 SV=1 30 344 2.0E-57
sp|B4S922|HEM3_PROA2 Porphobilinogen deaminase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hemC PE=3 SV=1 30 344 3.0E-57
sp|Q1LU25|HEM3_BAUCH Porphobilinogen deaminase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hemC PE=3 SV=1 26 341 3.0E-57
sp|B7N295|HEM3_ECO81 Porphobilinogen deaminase OS=Escherichia coli O81 (strain ED1a) GN=hemC PE=3 SV=1 26 350 3.0E-57
sp|B7MH66|HEM3_ECO45 Porphobilinogen deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hemC PE=3 SV=1 26 350 3.0E-57
sp|Q8Y6X5|HEM3_LISMO Porphobilinogen deaminase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemC PE=3 SV=1 30 344 3.0E-57
sp|A6VE37|HEM3_PSEA7 Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain PA7) GN=hemC PE=3 SV=1 28 344 4.0E-57
sp|Q8FBP1|HEM3_ECOL6 Porphobilinogen deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hemC PE=3 SV=2 26 350 4.0E-57
sp|A1TXW9|HEM3_MARHV Porphobilinogen deaminase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemC PE=3 SV=1 28 349 4.0E-57
sp|O66621|HEM3_AQUAE Porphobilinogen deaminase OS=Aquifex aeolicus (strain VF5) GN=hemC PE=3 SV=2 30 348 4.0E-57
sp|B2VG55|HEM3_ERWT9 Porphobilinogen deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemC PE=3 SV=1 27 349 5.0E-57
sp|B5EBG8|HEM3_GEOBB Porphobilinogen deaminase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hemC PE=3 SV=1 28 341 5.0E-57
sp|Q8XWW3|HEM3_RALSO Porphobilinogen deaminase OS=Ralstonia solanacearum (strain GMI1000) GN=hemC PE=3 SV=1 13 349 7.0E-57
sp|Q88B91|HEM3_PSESM Porphobilinogen deaminase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hemC PE=3 SV=1 30 344 9.0E-57
sp|A0AJ05|HEM3_LISW6 Porphobilinogen deaminase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hemC PE=3 SV=1 30 344 1.0E-56
sp|Q83PH4|HEM3_SHIFL Porphobilinogen deaminase OS=Shigella flexneri GN=hemC PE=3 SV=2 26 350 2.0E-56
sp|Q31JG5|HEM3_THICR Porphobilinogen deaminase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemC PE=3 SV=1 28 344 3.0E-56
sp|A1JI86|HEM3_YERE8 Porphobilinogen deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hemC PE=3 SV=1 27 349 5.0E-56
sp|Q92BF8|HEM3_LISIN Porphobilinogen deaminase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemC PE=3 SV=1 30 344 5.0E-56
sp|B2G9H4|HEM3_LACRJ Porphobilinogen deaminase OS=Lactobacillus reuteri (strain JCM 1112) GN=hemC PE=3 SV=1 30 342 5.0E-56
sp|A5VM67|HEM3_LACRD Porphobilinogen deaminase OS=Lactobacillus reuteri (strain DSM 20016) GN=hemC PE=3 SV=1 30 342 5.0E-56
sp|O69110|HEM3_PAEMA Porphobilinogen deaminase OS=Paenibacillus macerans GN=hemC PE=3 SV=1 30 290 5.0E-56
sp|Q5ZRY6|HEM3_LEGPH Porphobilinogen deaminase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemC PE=3 SV=2 24 344 6.0E-56
sp|Q3ACT3|HEM3_CARHZ Porphobilinogen deaminase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hemC PE=3 SV=1 30 344 1.0E-55
sp|Q479S8|HEM3_DECAR Porphobilinogen deaminase OS=Dechloromonas aromatica (strain RCB) GN=hemC PE=3 SV=1 30 344 1.0E-55
sp|C3K424|HEM3_PSEFS Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain SBW25) GN=hemC PE=3 SV=1 28 344 1.0E-55
sp|A6Q3S1|HEM3_NITSB Porphobilinogen deaminase OS=Nitratiruptor sp. (strain SB155-2) GN=hemC PE=3 SV=1 28 342 2.0E-55
sp|Q30S90|HEM3_SULDN Porphobilinogen deaminase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hemC PE=3 SV=1 30 341 2.0E-55
sp|Q7W785|HEM3_BORPA Porphobilinogen deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemC PE=3 SV=1 28 351 2.0E-55
sp|Q7WKM1|HEM3_BORBR Porphobilinogen deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemC PE=3 SV=1 28 351 2.0E-55
sp|Q7VVU9|HEM3_BORPE Porphobilinogen deaminase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemC PE=3 SV=1 28 351 3.0E-55
sp|B1HVD6|HEM3_LYSSC Porphobilinogen deaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=hemC PE=3 SV=1 30 285 3.0E-55
sp|Q21XQ9|HEM3_RHOFT Porphobilinogen deaminase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hemC PE=3 SV=1 26 332 3.0E-55
sp|A9VIT8|HEM3_BACWK Porphobilinogen deaminase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemC PE=3 SV=1 30 345 4.0E-55
sp|Q5SLE8|HEM3_THET8 Porphobilinogen deaminase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hemC PE=3 SV=1 27 344 4.0E-55
sp|Q72H57|HEM3_THET2 Porphobilinogen deaminase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hemC PE=3 SV=1 27 344 4.0E-55
sp|Q4K3X3|HEM3_PSEF5 Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hemC PE=3 SV=1 28 344 4.0E-55
sp|Q5X1F2|HEM3_LEGPA Porphobilinogen deaminase OS=Legionella pneumophila (strain Paris) GN=hemC PE=3 SV=1 24 344 7.0E-55
sp|A5VWX3|HEM3_PSEP1 Porphobilinogen deaminase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hemC PE=3 SV=1 28 344 8.0E-55
sp|Q88RE5|HEM3_PSEPK Porphobilinogen deaminase OS=Pseudomonas putida (strain KT2440) GN=hemC PE=3 SV=1 28 344 1.0E-54
sp|Q43082|HEM3_PEA Porphobilinogen deaminase, chloroplastic OS=Pisum sativum GN=HEMC PE=1 SV=1 27 335 1.0E-54
sp|A3CL78|HEM3_STRSV Porphobilinogen deaminase OS=Streptococcus sanguinis (strain SK36) GN=hemC PE=3 SV=1 27 280 2.0E-54
sp|Q817R0|HEM3_BACCR Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|B7HE96|HEM3_BACC4 Porphobilinogen deaminase OS=Bacillus cereus (strain B4264) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|B7IIX5|HEM3_BACC2 Porphobilinogen deaminase OS=Bacillus cereus (strain G9842) GN=hemC PE=3 SV=1 30 345 3.0E-54
sp|Q5WT65|HEM3_LEGPL Porphobilinogen deaminase OS=Legionella pneumophila (strain Lens) GN=hemC PE=3 SV=1 24 344 4.0E-54
sp|A5CW34|HEM3_VESOH Porphobilinogen deaminase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hemC PE=3 SV=1 28 342 4.0E-54
sp|Q3BXV3|HEM3_XANC5 Porphobilinogen deaminase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hemC PE=3 SV=1 26 341 9.0E-54
sp|C1ETR0|HEM3_BACC3 Porphobilinogen deaminase OS=Bacillus cereus (strain 03BB102) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|A0RJ81|HEM3_BACAH Porphobilinogen deaminase OS=Bacillus thuringiensis (strain Al Hakam) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B7JQ57|HEM3_BACC0 Porphobilinogen deaminase OS=Bacillus cereus (strain AH820) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q72ZW2|HEM3_BACC1 Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q1J288|HEM3_DEIGD Porphobilinogen deaminase OS=Deinococcus geothermalis (strain DSM 11300) GN=hemC PE=3 SV=1 29 343 1.0E-53
sp|B9IZ39|HEM3_BACCQ Porphobilinogen deaminase OS=Bacillus cereus (strain Q1) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B7HQM4|HEM3_BACC7 Porphobilinogen deaminase OS=Bacillus cereus (strain AH187) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B8D8B0|HEM3_BUCAT Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|P57651|HEM3_BUCAI Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|B8D8F3|HEM3_BUCA5 Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hemC PE=3 SV=1 30 345 1.0E-53
sp|Q81LC7|HEM3_BACAN Porphobilinogen deaminase OS=Bacillus anthracis GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|C3L6Z5|HEM3_BACAC Porphobilinogen deaminase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|C3P9E9|HEM3_BACAA Porphobilinogen deaminase OS=Bacillus anthracis (strain A0248) GN=hemC PE=3 SV=1 30 345 2.0E-53
sp|Q180R9|HEM3_PEPD6 Porphobilinogen deaminase OS=Peptoclostridium difficile (strain 630) GN=hemC PE=3 SV=1 30 280 2.0E-53
sp|Q6HD62|HEM3_BACHK Porphobilinogen deaminase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemC PE=3 SV=1 30 345 3.0E-53
sp|A9IKF3|HEM3_BORPD Porphobilinogen deaminase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hemC PE=3 SV=1 30 341 4.0E-53
sp|Q6H6D2|HEM3_ORYSJ Porphobilinogen deaminase, chloroplastic OS=Oryza sativa subsp. japonica GN=HEMC PE=2 SV=1 26 304 4.0E-53
sp|A7I1S0|HEM3_CAMHC Porphobilinogen deaminase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hemC PE=3 SV=1 30 338 5.0E-53
sp|Q8CXC0|HEM3_OCEIH Porphobilinogen deaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hemC PE=3 SV=1 30 281 6.0E-53
sp|B2SMV3|HEM3_XANOP Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hemC PE=3 SV=1 26 344 7.0E-53
sp|Q2NYU4|HEM3_XANOM Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hemC PE=3 SV=1 26 344 7.0E-53
sp|Q2T071|HEM3_BURTA Porphobilinogen deaminase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hemC PE=3 SV=1 28 347 7.0E-53
sp|A0LRF1|HEM3_ACIC1 Porphobilinogen deaminase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=hemC PE=3 SV=1 23 343 8.0E-53
sp|Q633Y0|HEM3_BACCZ Porphobilinogen deaminase OS=Bacillus cereus (strain ZK / E33L) GN=hemC PE=3 SV=1 30 345 8.0E-53
sp|B1YJV1|HEM3_EXIS2 Porphobilinogen deaminase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hemC PE=3 SV=1 30 281 1.0E-52
sp|A8ERI4|HEM3_ARCB4 Porphobilinogen deaminase OS=Arcobacter butzleri (strain RM4018) GN=hemC PE=3 SV=1 30 342 2.0E-52
sp|A9KDC4|HEM3_COXBN Porphobilinogen deaminase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|B6J6K0|HEM3_COXB1 Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuK_Q154) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|Q83A37|HEM3_COXBU Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|B6J3T6|HEM3_COXB2 Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuG_Q212) GN=hemC PE=3 SV=1 30 345 2.0E-52
sp|Q8PPR3|HEM3_XANAC Porphobilinogen deaminase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hemC PE=3 SV=1 26 341 3.0E-52
sp|B1JWR0|HEM3_BURCC Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain MC0-3) GN=hemC PE=3 SV=1 28 346 3.0E-52
sp|C4L4J6|HEM3_EXISA Porphobilinogen deaminase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemC PE=3 SV=1 30 345 3.0E-52
sp|B4E8C4|HEM3_BURCJ Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hemC PE=3 SV=1 28 346 4.0E-52
sp|A9N910|HEM3_COXBR Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=hemC PE=3 SV=1 30 345 4.0E-52
sp|Q5GVL2|HEM3_XANOR Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hemC PE=3 SV=1 26 344 7.0E-52
sp|Q43316|HEM3_ARATH Porphobilinogen deaminase, chloroplastic OS=Arabidopsis thaliana GN=HEMC PE=1 SV=1 27 308 8.0E-52
sp|Q0BCU9|HEM3_BURCM Porphobilinogen deaminase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hemC PE=3 SV=1 24 350 8.0E-52
sp|A5EW83|HEM3_DICNV Porphobilinogen deaminase OS=Dichelobacter nodosus (strain VCS1703A) GN=hemC PE=3 SV=1 26 342 1.0E-51
sp|Q0A577|HEM3_ALKEH Porphobilinogen deaminase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hemC PE=3 SV=1 28 341 1.0E-51
sp|A4JGV4|HEM3_BURVG Porphobilinogen deaminase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hemC PE=3 SV=1 24 346 2.0E-51
sp|Q9RRY0|HEM3_DEIRA Porphobilinogen deaminase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hemC PE=3 SV=1 29 344 2.0E-51
sp|B0RNI9|HEM3_XANCB Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hemC PE=3 SV=1 26 341 2.0E-51
sp|P13446|HEM3_EUGGR Porphobilinogen deaminase, chloroplastic OS=Euglena gracilis PE=1 SV=1 12 303 2.0E-51
sp|A7NKU8|HEM3_ROSCS Porphobilinogen deaminase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hemC PE=3 SV=1 28 281 5.0E-51
sp|Q47LA7|HEM3_THEFY Porphobilinogen deaminase OS=Thermobifida fusca (strain YX) GN=hemC PE=3 SV=1 30 348 6.0E-51
sp|B5ERN6|HEM3_ACIF5 Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hemC PE=3 SV=1 28 310 7.0E-51
sp|B7JBH8|HEM3_ACIF2 Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hemC PE=3 SV=1 28 310 7.0E-51
sp|B3E2H7|HEM3_GEOLS Porphobilinogen deaminase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hemC PE=3 SV=1 28 344 1.0E-50
sp|A3N700|HEM3_BURP6 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 668) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q63W73|HEM3_BURPS Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain K96243) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q3JUW3|HEM3_BURP1 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1710b) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A3NSN6|HEM3_BURP0 Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1106a) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A1V5U0|HEM3_BURMS Porphobilinogen deaminase OS=Burkholderia mallei (strain SAVP1) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q62LC0|HEM3_BURMA Porphobilinogen deaminase OS=Burkholderia mallei (strain ATCC 23344) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A2SAH5|HEM3_BURM9 Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10229) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|A3MLK5|HEM3_BURM7 Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10247) GN=hemC PE=3 SV=1 28 347 2.0E-50
sp|Q8P536|HEM3_XANCP Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hemC PE=3 SV=1 26 341 2.0E-50
sp|Q4UYZ4|HEM3_XANC8 Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hemC PE=3 SV=1 26 341 2.0E-50
sp|Q8RFP5|HEM3_FUSNN Porphobilinogen deaminase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hemC PE=3 SV=1 30 329 6.0E-50
sp|A4IZY4|HEM3_FRATW Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemC PE=3 SV=1 28 343 6.0E-50
sp|Q1D8Z8|HEM3_MYXXD Porphobilinogen deaminase OS=Myxococcus xanthus (strain DK 1622) GN=hemC PE=3 SV=1 26 341 6.0E-50
sp|A7GYU4|HEM3_CAMC5 Porphobilinogen deaminase OS=Campylobacter curvus (strain 525.92) GN=hemC PE=3 SV=1 27 342 1.0E-49
sp|B2SE34|HEM3_FRATM Porphobilinogen deaminase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|Q2A5R3|HEM3_FRATH Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|A7N9H6|HEM3_FRATF Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|C1CYD9|HEM3_DEIDV Porphobilinogen deaminase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=hemC PE=3 SV=1 29 343 1.0E-49
sp|A7ZD37|HEM3_CAMC1 Porphobilinogen deaminase OS=Campylobacter concisus (strain 13826) GN=hemC PE=3 SV=1 28 342 1.0E-49
sp|Q0BP15|HEM3_FRATO Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemC PE=3 SV=1 28 343 1.0E-49
sp|Q5NI31|HEM3_FRATT Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|Q14JI3|HEM3_FRAT1 Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|A0Q481|HEM3_FRATN Porphobilinogen deaminase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemC PE=3 SV=1 28 343 3.0E-49
sp|B0TW04|HEM3_FRAP2 Porphobilinogen deaminase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hemC PE=3 SV=1 30 342 4.0E-49
sp|B2A1G7|HEM3_NATTJ Porphobilinogen deaminase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hemC PE=3 SV=1 30 341 8.0E-49
sp|Q1INI6|HEM3_KORVE Porphobilinogen deaminase OS=Koribacter versatilis (strain Ellin345) GN=hemC PE=3 SV=1 28 355 2.0E-48
sp|A1AX51|HEM3_RUTMC Porphobilinogen deaminase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hemC PE=3 SV=1 28 342 2.0E-48
sp|A9FDP9|HEM3_SORC5 Porphobilinogen deaminase OS=Sorangium cellulosum (strain So ce56) GN=hemC PE=3 SV=1 26 280 2.0E-48
sp|Q3YSA8|HEM3_EHRCJ Porphobilinogen deaminase OS=Ehrlichia canis (strain Jake) GN=hemC PE=3 SV=1 30 334 2.0E-48
sp|A5UU37|HEM3_ROSS1 Porphobilinogen deaminase OS=Roseiflexus sp. (strain RS-1) GN=hemC PE=3 SV=1 30 281 5.0E-48
sp|A5VSL5|HEM3_BRUO2 Porphobilinogen deaminase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hemC PE=3 SV=1 28 306 6.0E-48
sp|Q8FYI6|HEM3_BRUSU Porphobilinogen deaminase OS=Brucella suis biovar 1 (strain 1330) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|B0CID9|HEM3_BRUSI Porphobilinogen deaminase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|A9M8M2|HEM3_BRUC2 Porphobilinogen deaminase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q8YJB0|HEM3_BRUME Porphobilinogen deaminase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hemC PE=3 SV=2 28 306 7.0E-48
sp|C0RFD1|HEM3_BRUMB Porphobilinogen deaminase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q57B08|HEM3_BRUAB Porphobilinogen deaminase OS=Brucella abortus biovar 1 (strain 9-941) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q2YLM5|HEM3_BRUA2 Porphobilinogen deaminase OS=Brucella abortus (strain 2308) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|B2S842|HEM3_BRUA1 Porphobilinogen deaminase OS=Brucella abortus (strain S19) GN=hemC PE=3 SV=1 28 306 7.0E-48
sp|Q87CC9|HEM3_XYLFT Porphobilinogen deaminase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hemC PE=3 SV=1 27 343 1.0E-47
sp|B2I5K8|HEM3_XYLF2 Porphobilinogen deaminase OS=Xylella fastidiosa (strain M23) GN=hemC PE=3 SV=1 27 343 1.0E-47
sp|A0Q2B1|HEM3_CLONN Porphobilinogen deaminase OS=Clostridium novyi (strain NT) GN=hemC PE=3 SV=1 30 281 1.0E-47
sp|B4RC21|HEM3_PHEZH Porphobilinogen deaminase OS=Phenylobacterium zucineum (strain HLK1) GN=hemC PE=3 SV=1 27 341 3.0E-47
sp|Q7VRM4|HEM3_BLOFL Porphobilinogen deaminase OS=Blochmannia floridanus GN=hemC PE=3 SV=1 25 348 3.0E-47
sp|Q9WX16|HEM31_STRCO Porphobilinogen deaminase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC1 PE=3 SV=1 28 341 3.0E-47
sp|B0U2W8|HEM3_XYLFM Porphobilinogen deaminase OS=Xylella fastidiosa (strain M12) GN=hemC PE=3 SV=1 27 343 3.0E-47
sp|Q9PCX7|HEM3_XYLFA Porphobilinogen deaminase OS=Xylella fastidiosa (strain 9a5c) GN=hemC PE=3 SV=1 27 343 3.0E-47
sp|Q68WR3|HEM3_RICTY Porphobilinogen deaminase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemC PE=3 SV=1 30 286 2.0E-46
sp|A6WXJ2|HEM3_OCHA4 Porphobilinogen deaminase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hemC PE=3 SV=1 27 280 2.0E-46
sp|A8GNR5|HEM3_RICAH Porphobilinogen deaminase OS=Rickettsia akari (strain Hartford) GN=hemC PE=3 SV=1 30 286 2.0E-46
sp|B2FI06|HEM3_STRMK Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain K279a) GN=hemC PE=3 SV=1 30 342 2.0E-46
sp|Q2LQU2|HEM3_SYNAS Porphobilinogen deaminase OS=Syntrophus aciditrophicus (strain SB) GN=hemC PE=3 SV=1 28 349 2.0E-46
sp|Q7M8L2|HEM3_WOLSU Porphobilinogen deaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemC PE=3 SV=1 30 341 5.0E-46
sp|Q1MPL2|HEM3_LAWIP Porphobilinogen deaminase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=hemC PE=3 SV=1 28 345 6.0E-46
sp|B4SJT8|HEM3_STRM5 Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemC PE=3 SV=1 30 342 1.0E-45
sp|Q17W61|HEM3_HELAH Porphobilinogen deaminase OS=Helicobacter acinonychis (strain Sheeba) GN=hemC PE=3 SV=1 30 345 1.0E-45
sp|C4Z552|HEM3_EUBE2 Porphobilinogen deaminase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=hemC PE=3 SV=1 28 325 1.0E-45
sp|Q9ZD77|HEM3_RICPR Porphobilinogen deaminase OS=Rickettsia prowazekii (strain Madrid E) GN=hemC PE=3 SV=1 30 286 1.0E-45
sp|B6JKG8|HEM3_HELP2 Porphobilinogen deaminase OS=Helicobacter pylori (strain P12) GN=hemC PE=3 SV=1 30 342 2.0E-45
sp|P56140|HEM3_HELPY Porphobilinogen deaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemC PE=3 SV=1 30 342 2.0E-45
sp|Q491Z6|HEM3_BLOPB Porphobilinogen deaminase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hemC PE=3 SV=1 27 281 2.0E-45
sp|Q98EI7|HEM3_RHILO Porphobilinogen deaminase OS=Rhizobium loti (strain MAFF303099) GN=hemC PE=3 SV=1 26 328 2.0E-45
sp|B9KGA9|HEM3_CAMLR Porphobilinogen deaminase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=hemC PE=3 SV=1 30 342 3.0E-45
sp|B8DKW2|HEM3_DESVM Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hemC PE=3 SV=1 30 345 3.0E-45
sp|B5ZA04|HEM3_HELPG Porphobilinogen deaminase OS=Helicobacter pylori (strain G27) GN=hemC PE=3 SV=1 30 342 3.0E-45
sp|A8EYJ9|HEM3_RICCK Porphobilinogen deaminase OS=Rickettsia canadensis (strain McKiel) GN=hemC PE=3 SV=1 30 286 6.0E-45
sp|Q82P95|HEM32_STRAW Porphobilinogen deaminase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC2 PE=3 SV=1 21 344 7.0E-45
sp|Q9ZMJ7|HEM3_HELPJ Porphobilinogen deaminase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemC PE=3 SV=1 30 342 1.0E-44
sp|Q4ULA5|HEM3_RICFE Porphobilinogen deaminase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemC PE=3 SV=1 30 286 1.0E-44
sp|Q1QQP5|HEM3_NITHX Porphobilinogen deaminase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hemC PE=3 SV=1 22 308 1.0E-44
sp|A7H4J7|HEM3_CAMJD Porphobilinogen deaminase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemC PE=3 SV=1 30 282 1.0E-44
sp|Q9PHW9|HEM3_CAMJE Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemC PE=3 SV=1 30 282 1.0E-44
sp|Q7VFE9|HEM3_HELHP Porphobilinogen deaminase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hemC PE=3 SV=1 30 342 1.0E-44
sp|A8FKW8|HEM3_CAMJ8 Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemC PE=3 SV=1 30 282 2.0E-44
sp|A6Q7Y4|HEM3_SULNB Porphobilinogen deaminase OS=Sulfurovum sp. (strain NBC37-1) GN=hemC PE=3 SV=1 30 342 2.0E-44
sp|Q5HVM1|HEM3_CAMJR Porphobilinogen deaminase OS=Campylobacter jejuni (strain RM1221) GN=hemC PE=3 SV=1 30 282 3.0E-44
sp|A1VYQ4|HEM3_CAMJJ Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemC PE=3 SV=1 30 282 3.0E-44
sp|Q2GGC7|HEM3_EHRCR Porphobilinogen deaminase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=hemC PE=3 SV=1 30 326 3.0E-44
sp|Q92LH7|HEM3_RHIME Porphobilinogen deaminase OS=Rhizobium meliloti (strain 1021) GN=hemC PE=3 SV=1 28 280 4.0E-44
sp|Q92HR5|HEM3_RICCN Porphobilinogen deaminase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemC PE=3 SV=1 30 286 5.0E-44
sp|C3PNS9|HEM3_RICAE Porphobilinogen deaminase OS=Rickettsia africae (strain ESF-5) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|A8GSI6|HEM3_RICRS Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Sheila Smith) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|B0BY00|HEM3_RICRO Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Iowa) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|C4K265|HEM3_RICPU Porphobilinogen deaminase OS=Rickettsia peacockii (strain Rustic) GN=hemC PE=3 SV=1 30 286 6.0E-44
sp|A8F1Y8|HEM3_RICM5 Porphobilinogen deaminase OS=Rickettsia massiliae (strain Mtu5) GN=hemC PE=3 SV=1 30 286 7.0E-44
sp|Q1RJN7|HEM3_RICBR Porphobilinogen deaminase OS=Rickettsia bellii (strain RML369-C) GN=hemC PE=3 SV=1 30 293 9.0E-44
sp|A8GXC8|HEM3_RICB8 Porphobilinogen deaminase OS=Rickettsia bellii (strain OSU 85-389) GN=hemC PE=3 SV=1 30 293 9.0E-44
sp|A9A1A1|HEM3_NITMS Probable porphobilinogen deaminase OS=Nitrosopumilus maritimus (strain SCM1) GN=hemC PE=3 SV=1 28 281 1.0E-43
sp|C6BYB7|HEM3_DESAD Porphobilinogen deaminase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=hemC PE=3 SV=1 28 344 2.0E-43
sp|Q3SVF3|HEM3_NITWN Porphobilinogen deaminase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hemC PE=3 SV=1 29 305 2.0E-43
sp|A1B853|HEM3_PARDP Porphobilinogen deaminase OS=Paracoccus denitrificans (strain Pd 1222) GN=hemC PE=3 SV=1 28 310 2.0E-43
sp|Q6AHF1|HEM3_LEIXX Porphobilinogen deaminase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hemC PE=3 SV=1 28 337 5.0E-43
sp|Q1AUK3|HEM3_RUBXD Porphobilinogen deaminase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hemC PE=3 SV=1 30 349 9.0E-43
sp|A0RNT3|HEM3_CAMFF Porphobilinogen deaminase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemC PE=3 SV=1 28 340 9.0E-43
sp|Q0BX92|HEM3_HYPNA Porphobilinogen deaminase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hemC PE=3 SV=1 28 349 1.0E-42
sp|Q9KY00|HEM32_STRCO Porphobilinogen deaminase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC2 PE=3 SV=1 23 344 2.0E-42
sp|Q82E76|HEM31_STRAW Porphobilinogen deaminase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC1 PE=3 SV=1 28 341 2.0E-42
sp|Q59293|HEM3_CLOJO Porphobilinogen deaminase OS=Clostridium josui GN=hemC PE=3 SV=2 30 280 3.0E-42
sp|Q72AV0|HEM3_DESVH Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hemC PE=3 SV=1 30 347 4.0E-42
sp|Q1GP41|HEM3_SPHAL Porphobilinogen deaminase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hemC PE=3 SV=1 28 307 4.0E-42
sp|Q30Y29|HEM3_DESAG Porphobilinogen deaminase OS=Desulfovibrio alaskensis (strain G20) GN=hemC PE=3 SV=1 30 344 5.0E-42
sp|A1VCX6|HEM3_DESVV Porphobilinogen deaminase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hemC PE=3 SV=1 30 347 6.0E-42
sp|B8I0Q8|HEM3_CLOCE Porphobilinogen deaminase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hemC PE=3 SV=1 30 280 7.0E-42
sp|Q8UC46|HEM3_AGRFC Porphobilinogen deaminase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hemC PE=3 SV=1 28 280 2.0E-41
sp|Q97MU4|HEM3_CLOAB Porphobilinogen deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hemC PE=3 SV=1 30 281 5.0E-41
sp|A5CDH4|HEM3_ORITB Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Boryong) GN=hemC PE=3 SV=1 27 286 6.0E-41
sp|Q6AB05|HEM3_PROAC Porphobilinogen deaminase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hemC PE=3 SV=2 26 281 7.0E-41
sp|B2UXC4|HEM3_CLOBA Porphobilinogen deaminase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hemC PE=3 SV=1 30 334 9.0E-41
sp|Q73SS0|HEM3_MYCPA Porphobilinogen deaminase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hemC PE=3 SV=1 27 352 1.0E-40
sp|Q49808|HEM3_MYCLE Porphobilinogen deaminase OS=Mycobacterium leprae (strain TN) GN=hemC PE=3 SV=2 27 341 1.0E-40
sp|B9DZL6|HEM3_CLOK1 Porphobilinogen deaminase OS=Clostridium kluyveri (strain NBRC 12016) GN=hemC PE=3 SV=1 28 328 2.0E-40
sp|A7GBW3|HEM3_CLOBL Porphobilinogen deaminase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B1KY15|HEM3_CLOBM Porphobilinogen deaminase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B1IHD1|HEM3_CLOBK Porphobilinogen deaminase OS=Clostridium botulinum (strain Okra / Type B1) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|C1FVB9|HEM3_CLOBJ Porphobilinogen deaminase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hemC PE=3 SV=1 28 285 2.0E-40
sp|B2US69|HEM3_HELPS Porphobilinogen deaminase OS=Helicobacter pylori (strain Shi470) GN=hemC PE=3 SV=1 30 342 3.0E-40
sp|Q5YP70|HEM3_NOCFA Porphobilinogen deaminase OS=Nocardia farcinica (strain IFM 10152) GN=hemC PE=3 SV=1 20 349 4.0E-40
sp|A5I0B2|HEM3_CLOBH Porphobilinogen deaminase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hemC PE=3 SV=1 28 285 4.0E-40
sp|A7FSG8|HEM3_CLOB1 Porphobilinogen deaminase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hemC PE=3 SV=1 28 285 4.0E-40
sp|A4T340|HEM3_MYCGI Porphobilinogen deaminase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hemC PE=3 SV=1 27 342 4.0E-40
sp|A0QLI0|HEM3_MYCA1 Porphobilinogen deaminase OS=Mycobacterium avium (strain 104) GN=hemC PE=3 SV=1 27 352 4.0E-40
sp|B2TPD7|HEM3_CLOBB Porphobilinogen deaminase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=hemC PE=3 SV=1 30 334 4.0E-40
sp|C0R2M3|HEM3_WOLWR Porphobilinogen deaminase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hemC PE=3 SV=1 30 332 5.0E-40
sp|A8MGE4|HEM3_ALKOO Porphobilinogen deaminase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hemC PE=3 SV=1 30 280 6.0E-40
sp|A6LSY5|HEM3_CLOB8 Porphobilinogen deaminase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hemC PE=3 SV=1 28 333 2.0E-39
sp|A0PW29|HEM3_MYCUA Porphobilinogen deaminase OS=Mycobacterium ulcerans (strain Agy99) GN=hemC PE=3 SV=1 27 341 2.0E-39
sp|P9WMP3|HEM3_MYCTU Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hemC PE=1 SV=1 27 341 3.0E-39
sp|P9WMP2|HEM3_MYCTO Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|A5TZP0|HEM3_MYCTA Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|C1AKJ0|HEM3_MYCBT Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|A1KFY6|HEM3_MYCBP Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|P64337|HEM3_MYCBO Porphobilinogen deaminase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hemC PE=3 SV=1 27 341 3.0E-39
sp|C3L2Z3|HEM3_CLOB6 Porphobilinogen deaminase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hemC PE=3 SV=1 28 285 3.0E-39
sp|Q0W5T2|HEM3_METAR Probable porphobilinogen deaminase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hemC PE=3 SV=1 28 282 3.0E-39
sp|A8ZWG5|HEM3_DESOH Porphobilinogen deaminase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hemC PE=3 SV=1 30 279 4.0E-39
sp|B0T287|HEM3_CAUSK Porphobilinogen deaminase OS=Caulobacter sp. (strain K31) GN=hemC PE=3 SV=1 28 281 4.0E-39
sp|Q1CUR5|HEM3_HELPH Porphobilinogen deaminase OS=Helicobacter pylori (strain HPAG1) GN=hemC PE=3 SV=1 30 342 5.0E-39
sp|Q9ABZ8|HEM3_CAUCR Porphobilinogen deaminase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hemC PE=3 SV=1 28 281 7.0E-39
sp|B8GXG1|HEM3_CAUCN Porphobilinogen deaminase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hemC PE=3 SV=1 28 281 7.0E-39
sp|B2HRJ2|HEM3_MYCMM Porphobilinogen deaminase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hemC PE=3 SV=1 27 341 7.0E-39
sp|Q8XKG4|HEM3_CLOPE Porphobilinogen deaminase OS=Clostridium perfringens (strain 13 / Type A) GN=hemC PE=3 SV=1 30 344 3.0E-38
sp|A1T3D3|HEM3_MYCVP Porphobilinogen deaminase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hemC PE=3 SV=1 27 342 3.0E-38
sp|Q0TQG4|HEM3_CLOP1 Porphobilinogen deaminase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=hemC PE=3 SV=1 30 281 4.0E-38
sp|A3DIF0|HEM3_CLOTH Porphobilinogen deaminase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hemC PE=3 SV=1 30 279 4.0E-38
sp|Q11XT5|HEM3_CYTH3 Porphobilinogen deaminase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hemC PE=3 SV=1 30 345 9.0E-38
sp|Q57989|HEM3_METJA Probable porphobilinogen deaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hemC PE=3 SV=1 30 332 1.0E-37
sp|B1MHI5|HEM3_MYCA9 Porphobilinogen deaminase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hemC PE=3 SV=1 27 341 2.0E-37
sp|O29026|HEM3_ARCFU Probable porphobilinogen deaminase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hemC PE=3 SV=1 30 334 2.0E-37
sp|Q0ST16|HEM3_CLOPS Porphobilinogen deaminase OS=Clostridium perfringens (strain SM101 / Type A) GN=hemC PE=3 SV=1 30 281 2.0E-37
sp|A8MDU3|HEM3_CALMQ Probable porphobilinogen deaminase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hemC PE=3 SV=1 27 281 3.0E-36
sp|Q6L2G8|HEM3_PICTO Probable porphobilinogen deaminase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemC PE=3 SV=1 30 295 4.0E-36
sp|Q7UPN0|HEM3_RHOBA Porphobilinogen deaminase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemC PE=3 SV=1 23 344 6.0E-36
sp|B3CUP9|HEM3_ORITI Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Ikeda) GN=hemC PE=3 SV=1 27 281 7.0E-36
sp|C5CB88|HEM3_MICLC Porphobilinogen deaminase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hemC PE=3 SV=1 28 340 8.0E-36
sp|Q12WM8|HEM3_METBU Probable porphobilinogen deaminase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hemC PE=3 SV=1 30 281 9.0E-36
sp|A4QB59|HEM3_CORGB Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain R) GN=hemC PE=3 SV=1 28 341 1.0E-35
sp|Q8NT90|HEM3_CORGL Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hemC PE=3 SV=1 28 341 2.0E-35
sp|P30527|HEM3_YERIN Porphobilinogen deaminase (Fragment) OS=Yersinia intermedia GN=hemC PE=3 SV=1 27 213 5.0E-35
sp|Q8FSF7|HEM3_COREF Porphobilinogen deaminase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hemC PE=3 SV=1 28 341 1.0E-34
sp|Q8TT56|HEM3_METAC Probable porphobilinogen deaminase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hemC PE=3 SV=1 30 329 2.0E-34
sp|Q46CH0|HEM3_METBF Probable porphobilinogen deaminase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hemC PE=3 SV=1 30 307 2.0E-34
sp|A8AAB4|HEM3_IGNH4 Probable porphobilinogen deaminase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hemC PE=3 SV=1 28 329 3.0E-34
sp|A4WN24|HEM3_PYRAR Probable porphobilinogen deaminase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=hemC PE=3 SV=1 30 281 8.0E-34
sp|Q8PW57|HEM3_METMA Probable porphobilinogen deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hemC PE=3 SV=1 30 310 2.0E-33
sp|A2BL26|HEM3_HYPBU Probable porphobilinogen deaminase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=hemC PE=3 SV=1 28 314 5.0E-33
sp|Q8ZYW7|HEM3_PYRAE Probable porphobilinogen deaminase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hemC PE=3 SV=1 28 329 6.0E-33
sp|A1RQK2|HEM3_PYRIL Probable porphobilinogen deaminase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=hemC PE=3 SV=1 28 308 1.0E-32
sp|Q6NJK0|HEM3_CORDI Porphobilinogen deaminase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hemC PE=3 SV=1 28 341 2.0E-32
sp|C3PKG2|HEM3_CORA7 Porphobilinogen deaminase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hemC PE=3 SV=1 27 343 6.0E-32
sp|O26960|HEM3_METTH Probable porphobilinogen deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hemC PE=3 SV=1 31 282 2.0E-31
sp|Q97B26|HEM3_THEVO Probable porphobilinogen deaminase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemC PE=3 SV=1 30 306 3.0E-31
sp|A4XK06|HEM3_CALS8 Porphobilinogen deaminase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hemC PE=3 SV=1 30 282 5.0E-31
sp|Q8TXC8|HEM3_METKA Probable porphobilinogen deaminase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hemC PE=3 SV=2 25 282 1.0E-30
sp|B1YDP0|HEM3_PYRNV Probable porphobilinogen deaminase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=hemC PE=3 SV=1 28 281 1.0E-29
sp|A3MWV7|HEM3_PYRCJ Probable porphobilinogen deaminase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hemC PE=3 SV=1 28 281 1.0E-28
sp|Q9HKM5|HEM3_THEAC Probable porphobilinogen deaminase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemC PE=3 SV=1 30 310 2.0E-28
sp|A4YD92|HEM3_METS5 Probable porphobilinogen deaminase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hemC PE=3 SV=1 30 282 2.0E-25
sp|Q980U4|HEM3_SULSO Probable porphobilinogen deaminase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hemC PE=3 SV=1 30 282 2.0E-25
sp|C3NF70|HEM3_SULIN Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MYD9|HEM3_SULIM Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MZR8|HEM3_SULIA Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.27) GN=hemC PE=3 SV=1 30 282 4.0E-25
sp|C3MJ21|HEM3_SULIL Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hemC PE=3 SV=1 30 282 5.0E-25
sp|C4KIZ9|HEM3_SULIK Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hemC PE=3 SV=1 30 282 5.0E-25
sp|C3N841|HEM3_SULIY Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hemC PE=3 SV=1 30 282 6.0E-25
sp|Q976H1|HEM3_SULTO Probable porphobilinogen deaminase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hemC PE=3 SV=1 30 336 1.0E-23
sp|Q9PK95|HEM3_CHLMU Probable porphobilinogen deaminase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=hemC PE=3 SV=1 30 209 1.0E-21
sp|Q9HMY5|HEM3_HALSA Probable porphobilinogen deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hemC PE=3 SV=1 28 188 8.0E-21
sp|Q9Y9J0|HEM3_AERPE Probable porphobilinogen deaminase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hemC PE=3 SV=2 30 280 8.0E-20
sp|O84301|HEM3_CHLTR Probable porphobilinogen deaminase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=hemC PE=3 SV=1 30 209 1.0E-18
sp|Q9Z9C9|HEM3_CHLPN Probable porphobilinogen deaminase OS=Chlamydia pneumoniae GN=hemC PE=3 SV=1 30 214 8.0E-17
sp|P40129|HEM3_DICCH Porphobilinogen deaminase (Fragment) OS=Dickeya chrysanthemi GN=hemC PE=3 SV=1 26 111 3.0E-09
sp|Q9HMY5|HEM3_HALSA Probable porphobilinogen deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hemC PE=3 SV=1 181 342 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0033014 tetrapyrrole biosynthetic process Yes
GO:0004418 hydroxymethylbilane synthase activity Yes
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5911
MAEAQPPTEEAASRPGDVAGGGSAATVFNVGTRKSPLALAQTDIIVSALQALFPTSSFPVHGMTTTGDRDQHTAL
YNFGGKGLWTSQLEERLVRGELDLVVHSLKDMPTTLPAGCVLGCVTNREDPRDSLVVSRRVARDQGWRTLADLPP
GSVVGTSSVRRIAQLARRYPGLRFKDVRGNIQTRLQKLDDDPEMAAIVLAAAGLQRMKLGHRISQYLDGSDGGAG
VLHAVGQGALGVECRAGDERVLAALRRLEHPDTALACLAERSLMRALEGGCSVPIGVETSWPRPGRLRLRATVVS
AAGTDAVDADLADDVATHQAADELGRRVALDLLGRGADKILEAINAARPAPAAAPDKQ*
Coding >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA
Transcript >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA
Gene >Hirsu2|5911
ATGGCAGAGGCGCAACCCCCGACAGAAGAAGCAGCCTCGCGGCCTGGCGACGTCGCCGGCGGCGGCAGCGCGGCC
ACCGTCTTCAACGTGGGCACGCGCAAGTCGCCGTTGGCGCTGGCCCAGACGGACATCATCGTCTCGGCCCTGCAG
GCCCTCTTCCCGACCTCGTCGTTCCCGGTGCACGGCATGACGACGACGGGCGACCGCGACCAGCACACGGCGCTC
TACAACTTCGGTGGCAAGGGCTTGTGGACGTCGCAGCTGGAGGAGCGGCTCGTGCGCGGCGAGCTCGACCTCGTC
GTCCATTCGCTCAAGGACATGCCGACGACGCTGCCGGCTGGCTGCGTGCTCGGCTGCGTCACCAACCGCGAGGAC
CCGCGCGACAGCCTCGTCGTCAGCCGGCGCGTCGCGCGCGACCAGGGCTGGCGCACGCTGGCCGACCTGCCGCCC
GGGTCCGTCGTCGGCACCAGCAGCGTGCGGCGCATCGCCCAGCTGGCGCGCCGCTACCCGGGCCTGCGCTTCAAG
GACGTCCGCGGCAACATCCAGACGCGGCTGCAGAAGCTCGACGACGACCCGGAGATGGCCGCCATTGTGCTCGCC
GCCGCCGGCCTGCAGCGCATGAAGCTCGGCCACCGCATCTCGCAGTACCTCGACGGCAGCGACGGCGGCGCCGGC
GTCCTGCACGCTGTCGGTCAGGGCGCCCTGGGCGTCGAGTGCCGCGCCGGCGACGAGCGCGTCCTCGCCGCCCTG
CGCCGCCTCGAGCACCCGGACACCGCCCTCGCCTGCCTGGCCGAGCGAAGCCTGATGCGCGCCCTCGAGGGCGGC
TGCAGCGTCCCCATCGGCGTCGAGACCAGCTGGCCGCGCCCGGGCAGGCTGCGCCTCCGCGCCACCGTCGTCTCC
GCCGCCGGCACCGACGCCGTCGACGCCGACCTCGCCGACGACGTCGCCACCCACCAGGCCGCTGACGAGCTGGGG
AGACGCGTCGCCCTCGACCTCCTCGGCCGGGGGGCCGACAAGATCCTCGAGGCCATCAACGCGGCACGGCCGGCA
CCTGCTGCTGCGCCCGACAAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail