Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5904
Gene name
LocationContig_2993:77..788
Strand+
Gene length (bp)711
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01740 STAS STAS domain 1.1E-17 89 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 1 177 2.0E-47
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 1 207 4.0E-24
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 15 209 2.0E-19
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 40 224 4.0E-18
sp|A8J6J0|SULT2_CHLRE Proton/sulfate cotransporter 2 OS=Chlamydomonas reinhardtii GN=SULTR2 PE=2 SV=1 36 216 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 1 177 2.0E-47
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 1 207 4.0E-24
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 15 209 2.0E-19
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 40 224 4.0E-18
sp|A8J6J0|SULT2_CHLRE Proton/sulfate cotransporter 2 OS=Chlamydomonas reinhardtii GN=SULTR2 PE=2 SV=1 36 216 7.0E-16
sp|P53392|SUT2_STYHA High affinity sulfate transporter 2 OS=Stylosanthes hamata GN=ST2 PE=2 SV=1 36 182 9.0E-14
sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis thaliana GN=SULTR1;3 PE=2 SV=1 16 216 1.0E-13
sp|P53391|SUT1_STYHA High affinity sulfate transporter 1 OS=Stylosanthes hamata GN=ST1 PE=2 SV=1 36 182 1.0E-12
sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis thaliana GN=SULTR1;2 PE=1 SV=1 16 182 9.0E-12
sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis thaliana GN=SULTR1;1 PE=1 SV=2 16 182 2.0E-10
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2 16 178 5.0E-10
sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabidopsis thaliana GN=SULTR3;4 PE=2 SV=1 36 195 1.0E-09
sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis thaliana GN=SULTR3;1 PE=2 SV=1 36 221 3.0E-09
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabidopsis thaliana GN=SULTR3;5 PE=2 SV=1 36 225 2.0E-08
sp|P92946|SUT22_ARATH Sulfate transporter 2.2 OS=Arabidopsis thaliana GN=SULTR2;2 PE=1 SV=3 16 195 3.0E-08
sp|P53393|SUT3_STYHA Low affinity sulfate transporter 3 OS=Stylosanthes hamata GN=ST3 PE=2 SV=1 16 195 3.0E-08
sp|O04722|SUT21_ARATH Sulfate transporter 2.1 OS=Arabidopsis thaliana GN=SULTR2;1 PE=2 SV=1 2 195 6.0E-08
sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis thaliana GN=SULTR3;2 PE=2 SV=1 36 221 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 29 60 31

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5904
MISVVAYSLMEEAPHDISFFVHIRGWKELSLMAVIFLSTIFYSLALGIALGVGISLLLVIKHSTRPRIQILGRIP
GTNRFENAEADSASLEFVEGCLIVKIPEPLTFANTGELRARLRRLELYGTSRAHPALPRIRSQESNRNVIFDIHG
VTSMDGSGTQVLEEIVRGYRQRGVRVFFSRGPARRSHPVWQLMERSGIVALSGGESHFVMDVEEALRWTEYEESI
GVRSGDSGPRD*
Coding >Hirsu2|5904
ATGATCTCCGTCGTGGCCTATTCGCTGATGGAGGAGGCGCCGCATGACATCTCCTTCTTCGTCCACATTCGCGGC
TGGAAGGAGCTGTCGCTGATGGCCGTCATCTTCCTGTCGACCATCTTCTACTCGCTCGCGCTGGGCATCGCGCTC
GGGGTGGGCATCTCGCTGCTGCTGGTCATCAAGCACAGCACGCGGCCGCGGATCCAGATCCTGGGCCGCATCCCG
GGCACGAACCGGTTCGAGAACGCCGAGGCCGACAGCGCGAGCCTCGAGTTCGTCGAGGGCTGCCTGATCGTCAAG
ATCCCCGAGCCGCTGACGTTTGCCAACACGGGCGAGCTCCGGGCGCGGCTGCGGCGGCTCGAGCTGTACGGCACG
TCGCGCGCGCACCCGGCCCTGCCGCGGATCCGCAGCCAGGAGTCGAACCGCAACGTCATCTTCGACATCCACGGC
GTCACCTCGATGGACGGCTCCGGCACCCAGGTGCTGGAGGAGATCGTGCGCGGCTACCGCCAGCGCGGCGTCCGC
GTCTTCTTCTCGCGCGGGCCCGCCCGCCGCAGCCACCCGGTCTGGCAGCTGATGGAGCGCAGCGGCATCGTCGCC
CTCAGCGGCGGCGAGTCGCACTTCGTCATGGACGTCGAGGAGGCCCTGCGCTGGACCGAGTACGAGGAGAGCATC
GGCGTCAGGAGCGGCGACAGCGGCCCGCGCGACTGA
Transcript >Hirsu2|5904
ATGATCTCCGTCGTGGCCTATTCGCTGATGGAGGAGGCGCCGCATGACATCTCCTTCTTCGTCCACATTCGCGGC
TGGAAGGAGCTGTCGCTGATGGCCGTCATCTTCCTGTCGACCATCTTCTACTCGCTCGCGCTGGGCATCGCGCTC
GGGGTGGGCATCTCGCTGCTGCTGGTCATCAAGCACAGCACGCGGCCGCGGATCCAGATCCTGGGCCGCATCCCG
GGCACGAACCGGTTCGAGAACGCCGAGGCCGACAGCGCGAGCCTCGAGTTCGTCGAGGGCTGCCTGATCGTCAAG
ATCCCCGAGCCGCTGACGTTTGCCAACACGGGCGAGCTCCGGGCGCGGCTGCGGCGGCTCGAGCTGTACGGCACG
TCGCGCGCGCACCCGGCCCTGCCGCGGATCCGCAGCCAGGAGTCGAACCGCAACGTCATCTTCGACATCCACGGC
GTCACCTCGATGGACGGCTCCGGCACCCAGGTGCTGGAGGAGATCGTGCGCGGCTACCGCCAGCGCGGCGTCCGC
GTCTTCTTCTCGCGCGGGCCCGCCCGCCGCAGCCACCCGGTCTGGCAGCTGATGGAGCGCAGCGGCATCGTCGCC
CTCAGCGGCGGCGAGTCGCACTTCGTCATGGACGTCGAGGAGGCCCTGCGCTGGACCGAGTACGAGGAGAGCATC
GGCGTCAGGAGCGGCGACAGCGGCCCGCGCGACTGA
Gene >Hirsu2|5904
ATGATCTCCGTCGTGGCCTATTCGCTGATGGAGGAGGCGCCGCATGACATCTCCTTCTTCGTCCACATTCGCGGC
TGGAAGGAGCTGTCGCTGATGGCCGTCATCTTCCTGTCGACCATCTTCTACTCGCTCGCGCTGGGCATCGCGCTC
GGGGTGGGCATCTCGCTGCTGCTGGTCATCAAGCACAGCACGCGGCCGCGGATCCAGATCCTGGGCCGCATCCCG
GGCACGAACCGGTTCGAGAACGCCGAGGCCGACAGCGCGAGCCTCGAGTTCGTCGAGGGCTGCCTGATCGTCAAG
ATCCCCGAGCCGCTGACGTTTGCCAACACGGGCGAGCTCCGGGCGCGGCTGCGGCGGCTCGAGCTGTACGGCACG
TCGCGCGCGCACCCGGCCCTGCCGCGGATCCGCAGCCAGGAGTCGAACCGCAACGTCATCTTCGACATCCACGGC
GTCACCTCGATGGACGGCTCCGGCACCCAGGTGCTGGAGGAGATCGTGCGCGGCTACCGCCAGCGCGGCGTCCGC
GTCTTCTTCTCGCGCGGGCCCGCCCGCCGCAGCCACCCGGTCTGGCAGCTGATGGAGCGCAGCGGCATCGTCGCC
CTCAGCGGCGGCGAGTCGCACTTCGTCATGGACGTCGAGGAGGCCCTGCGCTGGACCGAGTACGAGGAGAGCATC
GGCGTCAGGAGCGGCGACAGCGGCCCGCGCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail