Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|59
Gene name
LocationContig_1005:9613..9901
Strand-
Gene length (bp)288
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 2 60 7.0E-12
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 2 59 4.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 2 21 19
2 36 58 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|59
MLFFLFACLGNATYVLSILAYDPARGRYGRYLVVNLSWLAGSAVTLLMDLAVFAQYFLFRAAAADEDDDEGGGSP
ADDGAWDSRPLLERYDTTGR*
Coding >Hirsu2|59
ATGCTCTTCTTCCTCTTCGCCTGCCTCGGCAACGCCACCTACGTGCTGTCCATCCTGGCCTACGACCCGGCGCGC
GGCCGCTACGGCCGCTACCTCGTCGTCAACCTCAGCTGGCTGGCCGGCAGCGCCGTCACCCTCCTCATGGACCTG
GCCGTCTTCGCCCAGTACTTCCTCTTCCGCGCCGCCGCCGCCGACGAAGACGACGACGAAGGCGGCGGCAGCCCC
GCCGACGACGGCGCGTGGGACAGCCGGCCGCTGCTCGAGCGCTACGACACGACGGGCCGCTGA
Transcript >Hirsu2|59
ATGCTCTTCTTCCTCTTCGCCTGCCTCGGCAACGCCACCTACGTGCTGTCCATCCTGGCCTACGACCCGGCGCGC
GGCCGCTACGGCCGCTACCTCGTCGTCAACCTCAGCTGGCTGGCCGGCAGCGCCGTCACCCTCCTCATGGACCTG
GCCGTCTTCGCCCAGTACTTCCTCTTCCGCGCCGCCGCCGCCGACGAAGACGACGACGAAGGCGGCGGCAGCCCC
GCCGACGACGGCGCGTGGGACAGCCGGCCGCTGCTCGAGCGCTACGACACGACGGGCCGCTGA
Gene >Hirsu2|59
ATGCTCTTCTTCCTCTTCGCCTGCCTCGGCAACGCCACCTACGTGCTGTCCATCCTGGCCTACGACCCGGCGCGC
GGCCGCTACGGCCGCTACCTCGTCGTCAACCTCAGCTGGCTGGCCGGCAGCGCCGTCACCCTCCTCATGGACCTG
GCCGTCTTCGCCCAGTACTTCCTCTTCCGCGCCGCCGCCGCCGACGAAGACGACGACGAAGGCGGCGGCAGCCCC
GCCGACGACGGCGCGTGGGACAGCCGGCCGCTGCTCGAGCGCTACGACACGACGGGCCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail