Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5898
Gene name
LocationContig_299:15310..16251
Strand+
Gene length (bp)941
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 6.5E-12 81 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B4V1|PMU1_ARTBC Probable phosphoglycerate mutase ARB_03491 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03491 PE=1 SV=1 8 289 6.0E-70
sp|P36069|PMU1_YEAST Probable phosphoglycerate mutase PMU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMU1 PE=1 SV=1 10 268 3.0E-27
sp|Q5ACP5|PGA12_CANAL Phosphomutase-like protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA12 PE=1 SV=1 77 288 4.0E-25
sp|Q9FGF0|PGML1_ARATH Phosphoglycerate mutase-like protein 1 OS=Arabidopsis thaliana GN=At5g64460 PE=2 SV=1 72 267 2.0E-11
sp|Q8GY96|PGM_ARATH Phosphoglycerate mutase-like protein OS=Arabidopsis thaliana GN=PGM PE=2 SV=1 72 274 8.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5898
MASCKYRFSVVPGFFIDYVEAAKENPGSKLTRQPGLGLRERTYDSDGIRSNRGTLWMRFADYVETLNRQSPPGES
YKVLHLVRHGLAVHNVVMEKIGSASWKNHWSHLDGDGNLTWLDAKLTEQGIKQAKDISTFWAKASLDAGIPLPSK
LYTSPLARCLETTKLVYAPVMASHNLPFAPIVKENLRERLTDHTCDKRSPRSWISANYPDYALEPSFTETDELWK
ADVWESDAEHQARMQTLLEEIYSSDVASFVSLSTHSYTISAILEVVGAEDFRVAEGGVATLLVKGISLRD*
Coding >Hirsu2|5898
ATGGCCTCGTGCAAATACCGATTCTCCGTCGTCCCGGGATTCTTCATCGACTATGTAGAAGCTGCAAAGGAAAAT
CCTGGCTCAAAACTCACCCGCCAGCCCGGGCTGGGCCTACGCGAACGGACCTACGACTCGGACGGAATCCGATCC
AACCGCGGGACCCTATGGATGAGGTTCGCCGACTACGTCGAGACCCTCAATCGCCAAAGTCCACCCGGAGAGTCA
TACAAAGTGCTCCATCTCGTCCGCCACGGGCTGGCCGTCCACAACGTTGTCATGGAGAAGATTGGCTCCGCTTCT
TGGAAAAACCACTGGTCCCATCTCGACGGCGATGGCAACTTGACCTGGCTGGACGCGAAACTTACCGAGCAGGGT
ATCAAACAAGCCAAAGATATATCCACATTCTGGGCCAAGGCATCGCTTGACGCGGGCATTCCGCTGCCATCGAAA
CTGTATACCAGCCCTCTGGCTCGGTGCCTCGAAACCACAAAGCTAGTCTACGCCCCCGTCATGGCATCGCACAAC
CTGCCCTTCGCGCCTATCGTAAAGGAGAACCTCCGGGAGCGGTTGACGGACCATACTTGCGATAAGCGTAGTCCA
CGGTCGTGGATCTCTGCCAACTATCCCGACTACGCCCTGGAACCAAGTTTCACGGAGACGGACGAGTTGTGGAAA
GCGGATGTGTGGGAGAGCGATGCAGAACATCAGGCGCGTATGCAGACGCTACTGGAGGAGATATACTCGAGTGAT
GTGGCTAGCTTTGTTTCGCTGTCGACGCACTCATACACCATCTCTGCGATCCTGGAGGTGGTGGGGGCGGAAGAC
TTTCGGGTTGCTGAAGGGGGAGTCGCAACGTTACTCGTGAAAGGCATCAGTCTGAGGGATTAG
Transcript >Hirsu2|5898
ATGGCCTCGTGCAAATACCGATTCTCCGTCGTCCCGGGATTCTTCATCGACTATGTAGAAGCTGCAAAGGAAAAT
CCTGGCTCAAAACTCACCCGCCAGCCCGGGCTGGGCCTACGCGAACGGACCTACGACTCGGACGGAATCCGATCC
AACCGCGGGACCCTATGGATGAGGTTCGCCGACTACGTCGAGACCCTCAATCGCCAAAGTCCACCCGGAGAGTCA
TACAAAGTGCTCCATCTCGTCCGCCACGGGCTGGCCGTCCACAACGTTGTCATGGAGAAGATTGGCTCCGCTTCT
TGGAAAAACCACTGGTCCCATCTCGACGGCGATGGCAACTTGACCTGGCTGGACGCGAAACTTACCGAGCAGGGT
ATCAAACAAGCCAAAGATATATCCACATTCTGGGCCAAGGCATCGCTTGACGCGGGCATTCCGCTGCCATCGAAA
CTGTATACCAGCCCTCTGGCTCGGTGCCTCGAAACCACAAAGCTAGTCTACGCCCCCGTCATGGCATCGCACAAC
CTGCCCTTCGCGCCTATCGTAAAGGAGAACCTCCGGGAGCGGTTGACGGACCATACTTGCGATAAGCGTAGTCCA
CGGTCGTGGATCTCTGCCAACTATCCCGACTACGCCCTGGAACCAAGTTTCACGGAGACGGACGAGTTGTGGAAA
GCGGATGTGTGGGAGAGCGATGCAGAACATCAGGCGCGTATGCAGACGCTACTGGAGGAGATATACTCGAGTGAT
GTGGCTAGCTTTGTTTCGCTGTCGACGCACTCATACACCATCTCTGCGATCCTGGAGGTGGTGGGGGCGGAAGAC
TTTCGGGTTGCTGAAGGGGGAGTCGCAACGTTACTCGTGAAAGGCATCAGTCTGAGGGATTAG
Gene >Hirsu2|5898
ATGGCCTCGTGCAAATACCGATTCTCCGTCGTCCCGGGATTCTTCATCGACTATGTAGAAGCTGCAAAGGAAAAT
CCTGGCTCAAAACTCACCCGCCAGCCCGGGCTGGGCCTACGCGAACGGACCTACGACTCGGACGGAATCCGATCC
AACCGCGGGACCCTATGGATGAGGTTCGCCGACTACGTCGAGACCCTCAATCGCCAAAGTCCACCCGGAGAGTCA
TACAAAGTGCTCCATCTCGTCCGCCACGGGCTGGCCGTCCACAACGTTGTCATGGAGAAGATTGGCTCCGCTTCT
TGGAAAGTAGGTCTCTCTGCCCTCAGCAACGGCGAAGACTGGCTCACGCACCCTAAAAGAACCACTGGTCCCATC
TCGACGGCGATGGCAACTTGACCTGGCTGGACGCGAAACTTACCGAGCAGGGTATCAAACAAGCCAAAGATATAT
CCACATTCTGGGCCAAGGCATCGCTTGACGCGGGCATTCCGCTGCCATCGAAACTGTATACCAGCCCTCTGGCTC
GGTGCCTCGAAACCACAAAGCTAGTCTACGCCCCCGTCATGGCATCGCACAACCTGCCCTTCGCGCCTATCGTAA
AGGAGAACCTCCGGGAGCGGTTGACGGACCATACTTGCGATAAGCGTAGTCCACGGTCGTGGATCTCTGCCAACT
ATCCCGACTACGCCCTGGAACCAAGTTTCACGGAGACGGACGAGTTGTGGAAAGCGGATGTGTGGGAGAGCGATG
CAGAACATCAGGCGCGTATGCAGACGCTACTGGAGGAGATATACTCGAGTGATGTGGCTAGCTTTGTTTCGCTGT
CGACGCACTCATACACCATCTCTGCGATCCTGGAGGTGGTGGGGGCGGAAGACTTTCGGGTTGCTGAAGGGGGAG
TCGCAACGTTACTCGTGAAAGGCATCAGTCTGAGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail