Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5890
Gene name
LocationContig_2987:125..601
Strand-
Gene length (bp)476
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 4.9E-23 2 53

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.2614 0.5452 0.0512 0.0696 0.1216 0.0154 0.1476 0.0342 0.0265 0.3042

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6058
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02675
Ophiocordyceps kimflemingae Ophio5|4885
Ophiocordyceps subramaniannii Hirsu2|2205
Ophiocordyceps subramaniannii Hirsu2|5890 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5890
MVYDWDRHQQTCYRLYIEEGRSLEHIMAHMKTAHDFAPSKRAFQIQFKRWNFPPKQRPAHKNDRLVARVKELWER
NLAQPEMLRVLNEEDGFEIKARELMRLRTRNRWLLRAPNGDKSR*
Coding >Hirsu2|5890
ATGGTGTACGACTGGGATCGCCACCAGCAGACCTGTTACCGGCTCTACATCGAGGAGGGCAGGTCGCTCGAGCAC
ATCATGGCCCACATGAAGACGGCCCACGACTTTGCCCCGAGCAAGAGGGCCTTCCAGATCCAGTTCAAGCGCTGG
AACTTCCCCCCAAAGCAGCGGCCGGCCCACAAGAACGACCGCCTCGTGGCCCGCGTCAAGGAGCTCTGGGAGCGG
AACCTCGCCCAGCCGGAGATGCTAAGGGTACTCAACGAGGAGGACGGCTTCGAGATCAAGGCGCGAGAGCTGATG
CGCCTCAGGACGCGGAACAGGTGGCTGCTCCGGGCCCCCAACGGGGACAAGTCTCGCTGA
Transcript >Hirsu2|5890
ATGGTGTACGACTGGGATCGCCACCAGCAGACCTGTTACCGGCTCTACATCGAGGAGGGCAGGTCGCTCGAGCAC
ATCATGGCCCACATGAAGACGGCCCACGACTTTGCCCCGAGCAAGAGGGCCTTCCAGATCCAGTTCAAGCGCTGG
AACTTCCCCCCAAAGCAGCGGCCGGCCCACAAGAACGACCGCCTCGTGGCCCGCGTCAAGGAGCTCTGGGAGCGG
AACCTCGCCCAGCCGGAGATGCTAAGGGTACTCAACGAGGAGGACGGCTTCGAGATCAAGGCGCGAGAGCTGATG
CGCCTCAGGACGCGGAACAGGTGGCTGCTCCGGGCCCCCAACGGGGACAAGTCTCGCTGA
Gene >Hirsu2|5890
ATGGTGTACGACTGGGATCGCCACCAGCAGACCTGTTACCGGCTCTACATCGAGGAGGGCAGGTCGCTCGAGCAC
ATCATGGCCCACATGAAGACGGCCCACGACTTTGCCCCGAGGTGAGCTCGTCGCCGGTCCCGTCCGGCCCCCCCC
TTGCGCCGACGCGAAACTGAACGAGGACAAACCCGGCGCAGCAAGAGGGCCTTCCAGATCCAGTTCAAGCGCTGG
AACTTCCCCCCAAAGCAGCGGCCGGCCCACAAGAACGACCGCCTCGTGGCCCGCGTCAAGGAGCTCTGGGAGCGG
AACCTCGCCCAGCCGGAGATGCTAAGGGTACTCAACGAGGAGGACGGCTTCGAGATCAAGGCGCGAGAGCTGATG
CGCCTCAGGACGCGGAACAGGTGGCTGCTCCGGGCCCCCAACGGGGACAAGTCTCGTCGCGACGAAGACGACGAC
GACGACGAAGACGAGGTCCAGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail