Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5888
Gene name
LocationContig_2983:147..746
Strand-
Gene length (bp)599
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 1.2E-06 25 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0H8|ALG2_NEUCR Alpha-1,3/1,6-mannosyltransferase alg-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-2 PE=3 SV=1 15 89 3.0E-37
sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 16 89 7.0E-30
sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 16 89 1.0E-29
sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 15 87 1.0E-25
sp|Q755C1|ALG2_ASHGO Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG2 PE=3 SV=1 16 89 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0H8|ALG2_NEUCR Alpha-1,3/1,6-mannosyltransferase alg-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-2 PE=3 SV=1 15 89 3.0E-37
sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 16 89 7.0E-30
sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 16 89 1.0E-29
sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 15 87 1.0E-25
sp|Q755C1|ALG2_ASHGO Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG2 PE=3 SV=1 16 89 9.0E-25
sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 16 89 1.0E-24
sp|Q6FJJ9|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1 16 84 2.0E-24
sp|Q6C3V7|ALG2_YARLI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG2 PE=3 SV=1 16 89 2.0E-24
sp|Q59LF2|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1 16 87 7.0E-23
sp|Q6BVA4|ALG2_DEBHA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG2 PE=3 SV=2 6 87 2.0E-21
sp|Q9H553|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1 15 83 1.0E-18
sp|Q9DBE8|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=1 SV=2 15 83 3.0E-17
sp|Q7KWM5|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1 16 89 1.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5888
MPATGSDTSGGGGGTIVFFHPDLGIGGAERLVVDAAVGLQERGHRVVIFTNHCDPGHCFDECRDGTLDVRVRGSW
LVPPSVLGRLAIACRRCARAPSSSTSSSLPPAL*
Coding >Hirsu2|5888
ATGCCAGCGACGGGCAGCGACACGAGCGGCGGCGGCGGCGGCACCATCGTCTTCTTCCACCCGGACCTGGGCATC
GGCGGCGCCGAGCGGCTGGTGGTGGACGCCGCCGTCGGGCTGCAGGAGCGCGGCCACCGCGTCGTCATCTTCACC
AACCACTGCGACCCGGGCCACTGCTTCGACGAGTGCCGCGACGGCACGCTCGACGTCCGCGTCCGCGGCAGCTGG
CTGGTGCCGCCGTCGGTGCTGGGCCGGCTGGCGATCGCCTGCCGGCGCTGCGCCCGCGCGCCCTCTTCGTCGACC
AGCTCGTCTCTACCGCCGGCCCTTTGA
Transcript >Hirsu2|5888
ATGCCAGCGACGGGCAGCGACACGAGCGGCGGCGGCGGCGGCACCATCGTCTTCTTCCACCCGGACCTGGGCATC
GGCGGCGCCGAGCGGCTGGTGGTGGACGCCGCCGTCGGGCTGCAGGAGCGCGGCCACCGCGTCGTCATCTTCACC
AACCACTGCGACCCGGGCCACTGCTTCGACGAGTGCCGCGACGGCACGCTCGACGTCCGCGTCCGCGGCAGCTGG
CTGGTGCCGCCGTCGGTGCTGGGCCGGCTGGCGATCGCCTGCCGGCGCTGCGCCCGCGCGCCCTCTTCGTCGACC
AGCTCGTCTCTACCGCCGGCCCTTTGA
Gene >Hirsu2|5888
ATGCCAGCGACGGGCAGCGACACGAGCGGCGGCGGCGGCGGCACCATCGTCTTCTTCCACCCGGACCTGGGCATC
GGCGGCGCCGAGCGGCTGGTGGTGGACGCCGCCGTCGGGCTGCAGGAGCGCGGCCACCGCGTCGTCATCTTCACC
AACCACTGCGACCCGGGCCACTGCTTCGACGAGTGCCGCGACGGTCAGTGCCCCCCCGCCCCTCCCCCGAACCGT
TTGCGCGCCGCCGCCTCGAGCAAGCTGCTCCTCGATGCGCTCACACTCTCACACACACACACTACAGGCACGCTC
GACGTCCGCGTCCGCGGCAGCTGGCTGGTGCCGCCGTCGGTGCTGGGCCGGCTGGCGATCGCGTGCGCCGTCGCG
CGCCACGTGCACCTGCTGCTGCACGTGGCGCTGCTGTCGCGCGAGCTGCCGGCGCTGCGCCCGCGCGCCCTCTTC
GTCGACCAGCTGTCGGCCGGCCTGCCGCTGCTGCGCGCCCTCTGCGGCCGCGCCGTGCCCGCCCTCTTCTACTGC
CACTTCCCGGACCTGCTGCTGGCGCGCGGGCGCGACCGGTCGCGCCTCAAGCGTCTCTACCGCCGGCCCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail