Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5864
Gene name
LocationContig_2969:627..1393
Strand-
Gene length (bp)766
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 2.6E-35 2 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 2 114 1.0E-28
sp|Q969S0|S35B4_HUMAN UDP-xylose and UDP-N-acetylglucosamine transporter OS=Homo sapiens GN=SLC35B4 PE=1 SV=1 2 114 1.0E-21
sp|Q5R8M3|S35B4_PONAB UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii GN=SLC35B4 PE=2 SV=1 2 114 1.0E-21
sp|Q95KB4|S35B4_MACFA UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis GN=SLC35B4 PE=2 SV=1 2 114 1.0E-21
sp|Q8CIA5|S35B4_MOUSE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35b4 PE=2 SV=2 2 114 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 2 114 1.0E-28
sp|Q969S0|S35B4_HUMAN UDP-xylose and UDP-N-acetylglucosamine transporter OS=Homo sapiens GN=SLC35B4 PE=1 SV=1 2 114 1.0E-21
sp|Q5R8M3|S35B4_PONAB UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii GN=SLC35B4 PE=2 SV=1 2 114 1.0E-21
sp|Q95KB4|S35B4_MACFA UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis GN=SLC35B4 PE=2 SV=1 2 114 1.0E-21
sp|Q8CIA5|S35B4_MOUSE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35b4 PE=2 SV=2 2 114 4.0E-21
sp|P40004|YEA4_YEAST UDP-N-acetylglucosamine transporter YEA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA4 PE=1 SV=1 3 114 6.0E-21
sp|Q9W429|S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster GN=Efr PE=2 SV=1 1 114 2.0E-20
sp|Q00974|YEA4_KLULA UDP-N-acetylglucosamine transporter YEA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YEA4 PE=3 SV=1 1 127 5.0E-20
sp|Q7ZW46|S35B4_DANRE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Danio rerio GN=slc35b4 PE=2 SV=1 4 114 3.0E-18
sp|Q869W7|S35B4_DICDI UDP-N-acetylglucosamine transporter slc35b4 OS=Dictyostelium discoideum GN=slc35b4 PE=3 SV=2 2 119 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 68 85 17
3 90 112 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5864
MLGLIFGGCCSNVYALEAIINFEPASGTLLTFIQFLFVAATGYVAQFDKTRPPFFIAPAKVPMRRWMVNIILFFS
INLLNNHAFSYDISVPVHIILRSGGSIMTMAAGYIYGKRCERKDGPRDVHVASFR*
Coding >Hirsu2|5864
ATGCTAGGCCTAATTTTTGGCGGATGCTGCTCTAATGTTTATGCTCTTGAAGCCATCATCAACTTCGAGCCTGCC
AGCGGAACACTTCTGACATTTATTCAATTTCTGTTCGTGGCAGCCACGGGCTACGTAGCCCAGTTTGACAAAACC
AGGCCGCCGTTTTTTATCGCTCCTGCCAAGGTTCCAATGAGGCGATGGATGGTTAATATTATCCTCTTCTTCAGC
ATCAACCTTCTCAACAATCATGCCTTCAGCTACGACATATCTGTGCCGGTTCATATCATATTGCGGTCTGGGGGT
AGTATCATGACCATGGCGGCGGGATATATCTATGGCAAGAGATGCGAAAGAAAAGACGGACCCAGAGATGTCCAC
GTGGCCAGCTTTCGATAG
Transcript >Hirsu2|5864
ATGCTAGGCCTAATTTTTGGCGGATGCTGCTCTAATGTTTATGCTCTTGAAGCCATCATCAACTTCGAGCCTGCC
AGCGGAACACTTCTGACATTTATTCAATTTCTGTTCGTGGCAGCCACGGGCTACGTAGCCCAGTTTGACAAAACC
AGGCCGCCGTTTTTTATCGCTCCTGCCAAGGTTCCAATGAGGCGATGGATGGTTAATATTATCCTCTTCTTCAGC
ATCAACCTTCTCAACAATCATGCCTTCAGCTACGACATATCTGTGCCGGTTCATATCATATTGCGGTCTGGGGGT
AGTATCATGACCATGGCGGCGGGATATATCTATGGCAAGAGATGCGAAAGAAAAGACGGACCCAGAGATGTCCAC
GTGGCCAGCTTTCGATAG
Gene >Hirsu2|5864
ATGCTAGGCCTAATTTTTGGCGGATGCTGCTCTAATGTAATGTCGCATGCTGCCGCCGCCTCGTTGGTATGTAGT
TCGCCGTCCTTGATACTGACAACGGCTCGCCAGGTTTATGCTCTTGAAGCCATCATCAAGTAAGCAGTCGTTGTC
ATATTCACGGCACGAGTGGCTGCCCCAGGTCCCTCCACGCATGGATCAAGCTGACATGACATGACACTCGCTCGT
CGAAGCTTCGAGCCTGCCAGCGGTATAGAATCCCAGAAGCTTTTGATCCGTCGCATTGCTAAATTTGAGCCAGGA
ACACTTCTGACATTTATTCAATTTCTGTTCGTGGCAGCCACGGGCTACGTAGCCCAGTTTGACAAAACCAGGCCG
CCGTTTTTTATCGCTCCTGCCAAGGTTCCAATGAGGCGATGGATGGTTAATATTATCCTCTTCTTCAGCATCAAC
CTTCTCAACAATCATGCCTTCAGCTACGACATATCTGTGCCGGTTCATATCATATTGCGGTCTGGGGGTAGTATC
ATGACCATGGCGGCGGGATATATCTATGGCAAGAGGTATTCGAGCACTCAGATTTTGGCCGTTACGTTCCTCAGC
TTCGGCGTTGTGCTAGCCGCCTGGTCAGATGCGAAAGAAAAGGTGAACAACCCAGTCTTGAGGAGTGAACCGGAA
AATTACATTCGTCATGGGCCGACGTCTGATACCTTACTGGAACTCGTTCCTAGACGGACCCAGAGATGTCCACGT
GGCCAGCTTTCGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail