Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5850
Gene name
LocationContig_296:3930..10136
Strand-
Gene length (bp)6206
Transcript length (bp)6141
Coding sequence length (bp)6141
Protein length (aa) 2047

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07926 TPR_MLP1_2 TPR/MLP1/MLP2-like protein 1.1E-37 1069 1195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SA56|MLP1_CHATD Protein MLP1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=MLP1 PE=3 SV=1 1 1857 0.0E+00
sp|Q5EE04|TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis GN=tpr PE=1 SV=1 391 1447 3.0E-67
sp|F6ZDS4|TPR_MOUSE Nucleoprotein TPR OS=Mus musculus GN=Tpr PE=1 SV=1 187 1570 7.0E-67
sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 187 1578 3.0E-66
sp|O74424|NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup211 PE=1 SV=1 31 1595 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SA56|MLP1_CHATD Protein MLP1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=MLP1 PE=3 SV=1 1 1857 0.0E+00
sp|Q5EE04|TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis GN=tpr PE=1 SV=1 391 1447 3.0E-67
sp|F6ZDS4|TPR_MOUSE Nucleoprotein TPR OS=Mus musculus GN=Tpr PE=1 SV=1 187 1570 7.0E-67
sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 187 1578 3.0E-66
sp|O74424|NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup211 PE=1 SV=1 31 1595 4.0E-66
sp|F1MA98|TPR_RAT Nucleoprotein TPR OS=Rattus norvegicus GN=Tpr PE=1 SV=1 187 1590 2.0E-65
sp|Q02455|MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLP1 PE=1 SV=2 44 1402 4.0E-54
sp|A4GSN8|NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana GN=NUA PE=1 SV=1 195 1527 7.0E-33
sp|A1Z8P9|TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster GN=Mtor PE=1 SV=1 94 1549 6.0E-31
sp|Q9UTK5|ALM1_SCHPO Abnormal long morphology protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alm1 PE=1 SV=1 614 1475 2.0E-25
sp|P40457|MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLP2 PE=1 SV=1 377 1010 7.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006606 protein import into nucleus Yes
GO:0034504 protein localization to nucleus No
GO:0051649 establishment of localization in cell No
GO:0017038 protein import No
GO:0006886 intracellular protein transport No
GO:0045184 establishment of protein localization No
GO:0006913 nucleocytoplasmic transport No
GO:0015833 peptide transport No
GO:0071705 nitrogen compound transport No
GO:0033365 protein localization to organelle No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0051170 import into nucleus No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0015031 protein transport No
GO:0072594 establishment of protein localization to organelle No
GO:0042886 amide transport No
GO:0051169 nuclear transport No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0034613 cellular protein localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5850
MAAADVDVGYLAGHLGLDQPVVAALTTEPTVDLVSTLLRAVAVKAHEFDTLYAEKLQTDIELENAVRSAESRSQT
SKATAEKALHDVQEARQTLKEEETKRQSLENELQVLRAKSDDHAAEVKTLNDKIETLQSSNRTNLSIIESNTKRD
QTVADELAKQHQRNVELARQVASLQQSEQNAKGQVNSAKYREESLKQQLDLALRNTEWLEGELKAKSDEALKYRK
EKGARIAELQRENEDARSQVDALKRSEQQFRERLEAMQAKADEALVKLQKQEAAFATTVDSYKQELEDQRRLVDM
SDQLSKKHQERVRELEAERERLKDNYENEIRRVRLELEQERQTTTEMEHKIQQLETDIDELHARMDRSAHLPPPG
SMPQTPRPNGSVIGRAASPFGTPGSVRSKSAVTATQAIEQLFQVKGQLASEKRRNQQLSEELDGVIAALEAKSPE
ILELQAENETLRNEITRMSELSQQSFEERDVARKAARKMENVLNAAQTETKILKMQLRDLGTQIQMLVFSIYAFE
RGIDQLTEEEKFRLQQLEKGEVTEEALSDMSDTHQFVTQKLVVFKDIKSLQAKNEYLMRITRELAEQMESEEALA
AKHQAKLDHDQVETLQRELQHVLEESRSHKITTESYKAERDMFRRILQQRGAGGDEASMMRSSLDGSQRPPLVSI
EGDQSEALNEALRKLQSEYDSFRDAQNDVRKDLRDQIDHLTADKNSLQTERVKLLGDVRIESERREMLQGNYVAL
QTENVELQKRNQSLSETAAKQDIRTQQVAEELVEARGLVDSMRNETANLKAEKKLWKDIQDRLSRDNEGLIEEKN
RLNNLLATQQNLENERNISEAETRRKSQEKIDKLERELDEAQRKLAREAEEIKSLQLRKEFEARESQKRIDELMS
SLSQIREEHVGAKTTRDHLQARVDELTVELHNAEERVGRLQPRSTPRPGPTADNSHQEELEVEIRDLQNEISDLK
RDLDLANTKLEHAKVSAEQYRELSQSNEEALEDLRISQDQYRQEIESLMGEKDAKVKELDQRVNDVSAELSRSNN
ELSTLRDAQNEVSRRCDDEKVILQEELNRLKEDSARHLEAARYHQQDLRAQAEIASKAQQDYEKELVKHAEAAKL
VQQLRSELNGLKSQTASLRTEAESAKAALVQNEGSWDERRQQLEHEMAEVKARREDVNAQNKLLHQQLEGLTAQV
AALQQKRGGANEADDEAMSPVAVGDALDGLRELNSYLRREKEILEVQYDLKSQESKRLQQQMEYVQSQLDEARLK
LDQERSQAAQGGGRNSMAHQELMDKLNELNLYRESSAALRAENAQLKEQVMERNKKVEELEGRVQPLEAQIDNLK
TSKSYLEDEIKQIQEDRDRWQKRTEGILTKYGRVDPAEMESLRQTIEDLQKERDTLKESAGPLQARAIELESTLE
SEREGWQNTRAKLTEQFKERSKRLTGEKNDYIQRYNQLQEQLTQATSELEEAQKRAEDAGQEKTELEKEVQSFRQ
QVQELRQQGQQAQQAPQAQQTQSASAEVVAELEKRLTDTRKELEAVTAQKLGAEQQLENLRTELQVAVSEREQAL
QKLKDAAAAQAATQADAATETAQPAPTPPAPEEPVAVQEATAEAPPGGTLSDEERKALEDKLAAAEAKVLELEDK
VNQAQQASKERCDKMRDSLNNKLKESRVKFEEEAKRREEDLKLRFEQEKRIWQVENQNPKPAAPEQAPSTPAKDG
HAPPAPPATPAKDDQAPPAPATPATGGTPDLAQLDDTNMRQFLASNPTVKSIIAANVKKRVDVELAKAKGDTEAK
ISSARDQAQLMESKKSTLRINMAENKLKTANTKLGIVETAATETPQKPVVEVWEAVKKVGPAGAAAPSTPAKPAP
ATPAPASEPKQRSNASTPKPADQAAEAAAVDSTPAEAKPEEVKPAQAKPAEVKPAQAKPAPSSLPQHPPSLPQLP
LPPPPQQAQGGSRSSGIPMPRGGGRGRGGAYVPPGQRAASGNQEGGPGPATQGGRGRGRGGGGGFNPGASEFQPG
TKRPRGESEAGRGAKRARGGQ*
Coding >Hirsu2|5850
ATGGCGGCTGCAGATGTCGATGTCGGCTACCTCGCGGGCCACCTCGGCCTCGATCAGCCCGTAGTGGCGGCGCTG
ACGACGGAGCCCACCGTCGACCTCGTGTCTACACTGCTGCGGGCTGTAGCGGTCAAGGCCCACGAGTTCGACACC
TTGTACGCCGAGAAGCTGCAGACCGACATCGAGCTCGAAAATGCCGTCCGCAGCGCCGAGTCGCGGTCCCAGACC
TCTAAGGCCACCGCCGAAAAGGCGCTGCACGATGTGCAGGAGGCCAGGCAAACACTGAAGGAAGAAGAGACGAAG
CGCCAGTCTCTCGAAAACGAGCTGCAGGTCCTGCGGGCCAAGAGCGACGATCACGCAGCCGAGGTCAAGACCCTC
AACGACAAGATCGAGACGTTGCAATCCTCCAACCGCACCAACCTCAGCATCATCGAATCAAACACGAAACGCGAC
CAGACCGTCGCCGACGAGCTGGCCAAGCAGCACCAGCGAAACGTCGAGCTCGCCCGTCAGGTCGCCTCCCTGCAG
CAGTCCGAGCAGAACGCCAAGGGTCAGGTTAACAGCGCCAAGTACCGCGAGGAGTCGCTCAAGCAGCAGCTCGAC
CTGGCCCTCCGCAACACGGAATGGCTCGAGGGCGAGCTCAAGGCCAAGAGCGACGAGGCGCTTAAGTACAGGAAG
GAAAAGGGCGCCCGCATAGCCGAGCTGCAGAGAGAGAACGAGGACGCCAGGTCCCAGGTAGATGCCCTCAAGCGA
TCCGAGCAGCAGTTCCGCGAACGCCTCGAGGCCATGCAGGCCAAGGCAGACGAGGCCCTCGTCAAGCTGCAGAAG
CAGGAGGCCGCCTTCGCCACCACCGTCGACAGCTACAAACAGGAGCTCGAGGACCAGCGCAGGCTCGTCGACATG
TCCGACCAGTTGAGCAAGAAGCACCAGGAGCGCGTGCGGGAGCTCGAGGCGGAGAGGGAGCGCCTCAAGGACAAC
TATGAGAACGAGATCCGCCGGGTCCGCCTCGAGCTCGAGCAGGAGAGGCAAACCACGACGGAGATGGAGCACAAG
ATCCAGCAGCTCGAGACCGACATCGACGAACTCCACGCCCGCATGGACAGGAGCGCCCACCTCCCCCCGCCCGGC
TCGATGCCACAGACGCCGCGGCCCAACGGCTCCGTCATCGGCCGCGCCGCCTCGCCTTTTGGCACCCCGGGCTCC
GTCCGCAGCAAGTCGGCCGTCACCGCCACGCAAGCCATCGAGCAGCTATTCCAGGTCAAGGGCCAGCTCGCTAGC
GAGAAGAGGCGCAACCAGCAGCTCTCCGAGGAGCTTGACGGCGTCATCGCCGCCCTCGAGGCCAAGTCACCCGAG
ATCCTGGAGCTTCAGGCCGAGAACGAAACCCTTCGGAATGAAATTACCCGTATGTCAGAGCTGTCCCAGCAGAGC
TTCGAGGAGCGAGACGTGGCGAGGAAGGCGGCGCGCAAGATGGAAAACGTCCTCAACGCCGCCCAGACCGAGACG
AAGATCCTCAAGATGCAGCTGCGCGACCTAGGGACCCAGATCCAGATGCTCGTCTTCAGCATCTACGCCTTCGAA
AGGGGCATCGACCAGCTGACGGAAGAGGAGAAGTTCCGCCTGCAGCAGCTGGAAAAGGGAGAGGTCACGGAGGAG
GCCCTGTCCGATATGTCCGATACGCACCAGTTTGTCACGCAGAAGCTGGTCGTCTTCAAGGATATCAAGTCTCTG
CAGGCCAAGAACGAGTATCTGATGCGCATCACCCGGGAGCTTGCTGAGCAGATGGAGAGCGAGGAGGCCCTCGCC
GCGAAGCACCAGGCCAAGCTGGACCACGACCAGGTAGAAACGCTCCAGCGGGAGCTGCAACACGTGCTCGAGGAG
AGCAGATCCCACAAGATCACCACGGAGAGCTACAAGGCCGAACGCGACATGTTCCGACGCATCCTGCAGCAGCGA
GGCGCCGGCGGGGACGAGGCGTCCATGATGCGGAGCTCCCTCGACGGATCTCAGCGGCCCCCGCTCGTTAGCATC
GAGGGCGACCAGTCTGAGGCTCTCAACGAAGCGCTGCGGAAGCTCCAGTCCGAGTACGACAGCTTCAGGGACGCC
CAGAACGACGTCCGCAAAGACCTCCGCGACCAGATCGACCACCTAACCGCGGACAAGAACTCGCTACAGACGGAG
AGGGTCAAACTACTCGGCGATGTGAGAATCGAGTCGGAGAGGAGGGAGATGCTACAGGGCAACTACGTCGCCCTA
CAGACCGAAAACGTGGAGCTGCAGAAGCGGAACCAGAGCCTCTCCGAGACGGCCGCCAAGCAGGACATTCGCACT
CAGCAGGTCGCGGAGGAGCTCGTCGAGGCCAGGGGCCTGGTGGACAGCATGAGGAACGAAACAGCAAACCTCAAG
GCCGAAAAGAAGCTCTGGAAAGACATCCAGGATCGGCTGAGCCGGGACAACGAGGGCCTGATCGAGGAGAAGAAC
CGGCTGAACAACCTGCTTGCTACGCAGCAAAACCTGGAGAACGAACGCAACATTTCCGAGGCCGAGACACGGCGC
AAGTCTCAGGAAAAGATCGACAAGCTCGAGCGGGAGCTGGACGAGGCCCAGCGGAAGCTGGCTCGCGAGGCCGAA
GAAATCAAGAGCCTCCAGCTCAGGAAGGAGTTTGAGGCTAGAGAGTCCCAAAAGCGGATTGATGAGCTCATGTCC
AGCTTGAGCCAAATCCGCGAAGAGCACGTCGGCGCCAAGACGACCCGAGATCACCTCCAGGCGCGCGTCGACGAG
CTCACCGTGGAGCTGCACAACGCCGAGGAGCGCGTCGGGCGGCTTCAACCGCGGTCTACCCCTCGACCCGGCCCG
ACTGCCGACAACAGCCACCAAGAGGAGCTCGAGGTCGAGATCCGAGATCTCCAAAACGAGATCTCCGACCTCAAA
CGGGACTTGGACCTGGCAAACACGAAGCTCGAGCATGCCAAGGTGTCGGCCGAGCAGTACAGGGAGCTCAGCCAG
AGCAACGAGGAGGCACTGGAAGATCTCCGCATCTCGCAGGACCAATACAGGCAGGAGATTGAGTCGCTAATGGGA
GAGAAGGATGCCAAGGTGAAGGAGCTGGACCAGCGCGTCAACGACGTATCCGCGGAGCTGTCGCGGTCTAACAAC
GAGCTGTCGACCCTGCGGGACGCCCAGAACGAGGTTTCGCGCCGATGCGACGACGAGAAGGTCATCCTCCAGGAA
GAGCTCAACCGCCTCAAGGAGGACAGCGCCCGGCACCTCGAAGCCGCACGCTACCACCAGCAGGACCTGCGCGCC
CAGGCCGAGATCGCATCCAAGGCGCAACAGGACTACGAGAAGGAGCTCGTCAAGCACGCCGAGGCGGCCAAGCTC
GTCCAGCAGCTGCGCTCCGAGCTGAACGGGCTCAAGAGTCAGACGGCGTCGCTGAGGACCGAGGCTGAATCCGCC
AAGGCCGCCCTGGTGCAGAATGAGGGCTCCTGGGACGAGCGGCGGCAGCAGCTGGAGCACGAGATGGCCGAGGTG
AAGGCCAGGCGAGAAGACGTCAACGCCCAGAACAAGCTGCTCCACCAGCAGCTCGAGGGACTGACTGCCCAGGTC
GCGGCCCTGCAGCAGAAGCGCGGCGGCGCCAACGAGGCCGACGACGAAGCCATGTCTCCCGTTGCGGTCGGGGAC
GCCCTCGACGGCCTCCGCGAGCTCAACAGCTACCTGCGTCGGGAGAAGGAGATCCTCGAGGTCCAGTACGACCTG
AAGTCGCAGGAGTCGAAGCGGCTACAGCAACAGATGGAGTACGTGCAGTCCCAGCTCGACGAGGCCCGCCTCAAG
CTGGACCAGGAACGGAGCCAAGCCGCCCAGGGCGGAGGCCGGAACTCGATGGCCCACCAGGAGCTCATGGACAAG
CTCAACGAGCTAAATCTGTACCGTGAGAGCAGTGCGGCCCTGCGGGCCGAGAACGCCCAGCTGAAAGAGCAGGTC
ATGGAGAGGAACAAGAAGGTCGAGGAGCTGGAGGGCAGGGTCCAGCCGCTCGAGGCTCAGATCGACAATCTCAAA
ACGTCCAAATCGTATTTGGAAGACGAAATCAAGCAAATTCAGGAAGACCGCGACCGCTGGCAAAAGCGGACGGAG
GGCATCCTGACAAAGTACGGCCGCGTCGACCCCGCCGAAATGGAGTCGCTCCGGCAGACAATAGAGGATTTGCAG
AAGGAGCGCGACACCCTCAAGGAGTCCGCCGGACCGCTGCAGGCCAGAGCCATCGAGCTGGAGTCGACACTCGAA
AGCGAGCGCGAAGGATGGCAAAATACCCGTGCGAAGCTCACGGAACAGTTCAAAGAGAGGTCAAAGAGGCTCACG
GGCGAGAAGAACGACTACATCCAGCGGTACAACCAGCTGCAGGAACAGCTGACCCAGGCCACCAGCGAGCTCGAG
GAGGCGCAGAAGCGCGCCGAGGACGCCGGACAGGAAAAGACGGAGCTCGAGAAGGAGGTCCAGAGCTTCAGGCAG
CAGGTACAGGAGCTGCGCCAGCAGGGACAACAGGCGCAGCAGGCGCCACAGGCGCAGCAGACCCAGTCCGCTTCG
GCCGAGGTGGTGGCCGAGCTGGAGAAGAGGCTCACCGACACCCGCAAGGAGCTGGAGGCGGTCACCGCGCAGAAA
CTAGGTGCCGAGCAGCAACTGGAGAATCTGCGGACGGAGCTGCAGGTTGCCGTCTCGGAACGCGAGCAGGCCCTG
CAGAAGCTGAAGGACGCGGCGGCCGCGCAGGCTGCCACGCAGGCCGACGCCGCCACTGAAACTGCGCAGCCGGCC
CCGACACCGCCGGCCCCCGAGGAACCTGTCGCGGTCCAGGAGGCTACTGCTGAAGCCCCGCCCGGCGGCACTCTT
TCGGACGAGGAGAGGAAAGCGCTGGAGGACAAGCTTGCAGCGGCCGAGGCTAAGGTGCTTGAGCTAGAGGACAAG
GTCAACCAGGCGCAACAGGCTTCCAAAGAGCGCTGCGACAAGATGCGCGATTCCTTGAACAACAAACTGAAAGAA
AGCCGAGTGAAATTCGAGGAGGAGGCCAAGCGGAGAGAAGAGGACCTCAAGCTCAGGTTCGAGCAGGAGAAGCGC
ATTTGGCAGGTCGAGAACCAGAACCCCAAGCCTGCGGCTCCGGAGCAGGCGCCATCAACGCCGGCCAAGGACGGC
CATGCTCCGCCGGCGCCGCCAGCCACGCCTGCCAAGGACGACCAGGCTCCGCCGGCGCCTGCCACGCCTGCCACG
GGCGGCACCCCCGACTTGGCGCAACTGGACGATACGAACATGCGGCAGTTCCTGGCTTCGAACCCGACTGTTAAG
AGCATCATCGCAGCCAACGTAAAGAAGAGGGTCGACGTCGAGCTGGCCAAGGCCAAGGGAGACACGGAAGCTAAG
ATATCTTCGGCCCGCGACCAAGCCCAACTCATGGAGTCAAAGAAGTCGACCTTGCGCATCAACATGGCCGAGAAC
AAGCTGAAGACGGCCAACACGAAACTGGGCATCGTCGAAACGGCCGCGACCGAGACGCCCCAGAAGCCAGTCGTC
GAGGTTTGGGAGGCCGTGAAGAAGGTGGGCCCCGCGGGAGCAGCCGCTCCGTCAACGCCGGCCAAACCGGCGCCC
GCGACGCCGGCACCGGCCAGCGAGCCCAAACAGCGCAGCAACGCCTCGACCCCTAAGCCCGCGGACCAGGCGGCA
GAAGCAGCCGCAGTGGACTCCACACCGGCAGAAGCCAAGCCGGAAGAAGTCAAGCCTGCGCAAGCCAAGCCGGCA
GAAGTCAAGCCTGCGCAAGCCAAGCCGGCGCCGTCATCGTTGCCGCAACACCCACCCTCGCTGCCACAGCTGCCC
CTTCCACCGCCGCCGCAGCAGGCACAGGGCGGTTCTCGGTCTTCGGGCATCCCGATGCCACGGGGCGGCGGCCGT
GGACGAGGAGGCGCGTACGTGCCACCAGGACAGCGAGCGGCCAGCGGGAACCAGGAGGGCGGACCCGGTCCCGCG
ACGCAGGGGGGGCGGGGAAGAGGCCGGGGCGGCGGTGGAGGTTTCAATCCCGGAGCGTCGGAGTTTCAGCCCGGG
ACCAAAAGACCGCGGGGCGAGTCGGAAGCGGGCAGGGGAGCGAAGAGGGCGCGGGGAGGCCAGTAG
Transcript >Hirsu2|5850
ATGGCGGCTGCAGATGTCGATGTCGGCTACCTCGCGGGCCACCTCGGCCTCGATCAGCCCGTAGTGGCGGCGCTG
ACGACGGAGCCCACCGTCGACCTCGTGTCTACACTGCTGCGGGCTGTAGCGGTCAAGGCCCACGAGTTCGACACC
TTGTACGCCGAGAAGCTGCAGACCGACATCGAGCTCGAAAATGCCGTCCGCAGCGCCGAGTCGCGGTCCCAGACC
TCTAAGGCCACCGCCGAAAAGGCGCTGCACGATGTGCAGGAGGCCAGGCAAACACTGAAGGAAGAAGAGACGAAG
CGCCAGTCTCTCGAAAACGAGCTGCAGGTCCTGCGGGCCAAGAGCGACGATCACGCAGCCGAGGTCAAGACCCTC
AACGACAAGATCGAGACGTTGCAATCCTCCAACCGCACCAACCTCAGCATCATCGAATCAAACACGAAACGCGAC
CAGACCGTCGCCGACGAGCTGGCCAAGCAGCACCAGCGAAACGTCGAGCTCGCCCGTCAGGTCGCCTCCCTGCAG
CAGTCCGAGCAGAACGCCAAGGGTCAGGTTAACAGCGCCAAGTACCGCGAGGAGTCGCTCAAGCAGCAGCTCGAC
CTGGCCCTCCGCAACACGGAATGGCTCGAGGGCGAGCTCAAGGCCAAGAGCGACGAGGCGCTTAAGTACAGGAAG
GAAAAGGGCGCCCGCATAGCCGAGCTGCAGAGAGAGAACGAGGACGCCAGGTCCCAGGTAGATGCCCTCAAGCGA
TCCGAGCAGCAGTTCCGCGAACGCCTCGAGGCCATGCAGGCCAAGGCAGACGAGGCCCTCGTCAAGCTGCAGAAG
CAGGAGGCCGCCTTCGCCACCACCGTCGACAGCTACAAACAGGAGCTCGAGGACCAGCGCAGGCTCGTCGACATG
TCCGACCAGTTGAGCAAGAAGCACCAGGAGCGCGTGCGGGAGCTCGAGGCGGAGAGGGAGCGCCTCAAGGACAAC
TATGAGAACGAGATCCGCCGGGTCCGCCTCGAGCTCGAGCAGGAGAGGCAAACCACGACGGAGATGGAGCACAAG
ATCCAGCAGCTCGAGACCGACATCGACGAACTCCACGCCCGCATGGACAGGAGCGCCCACCTCCCCCCGCCCGGC
TCGATGCCACAGACGCCGCGGCCCAACGGCTCCGTCATCGGCCGCGCCGCCTCGCCTTTTGGCACCCCGGGCTCC
GTCCGCAGCAAGTCGGCCGTCACCGCCACGCAAGCCATCGAGCAGCTATTCCAGGTCAAGGGCCAGCTCGCTAGC
GAGAAGAGGCGCAACCAGCAGCTCTCCGAGGAGCTTGACGGCGTCATCGCCGCCCTCGAGGCCAAGTCACCCGAG
ATCCTGGAGCTTCAGGCCGAGAACGAAACCCTTCGGAATGAAATTACCCGTATGTCAGAGCTGTCCCAGCAGAGC
TTCGAGGAGCGAGACGTGGCGAGGAAGGCGGCGCGCAAGATGGAAAACGTCCTCAACGCCGCCCAGACCGAGACG
AAGATCCTCAAGATGCAGCTGCGCGACCTAGGGACCCAGATCCAGATGCTCGTCTTCAGCATCTACGCCTTCGAA
AGGGGCATCGACCAGCTGACGGAAGAGGAGAAGTTCCGCCTGCAGCAGCTGGAAAAGGGAGAGGTCACGGAGGAG
GCCCTGTCCGATATGTCCGATACGCACCAGTTTGTCACGCAGAAGCTGGTCGTCTTCAAGGATATCAAGTCTCTG
CAGGCCAAGAACGAGTATCTGATGCGCATCACCCGGGAGCTTGCTGAGCAGATGGAGAGCGAGGAGGCCCTCGCC
GCGAAGCACCAGGCCAAGCTGGACCACGACCAGGTAGAAACGCTCCAGCGGGAGCTGCAACACGTGCTCGAGGAG
AGCAGATCCCACAAGATCACCACGGAGAGCTACAAGGCCGAACGCGACATGTTCCGACGCATCCTGCAGCAGCGA
GGCGCCGGCGGGGACGAGGCGTCCATGATGCGGAGCTCCCTCGACGGATCTCAGCGGCCCCCGCTCGTTAGCATC
GAGGGCGACCAGTCTGAGGCTCTCAACGAAGCGCTGCGGAAGCTCCAGTCCGAGTACGACAGCTTCAGGGACGCC
CAGAACGACGTCCGCAAAGACCTCCGCGACCAGATCGACCACCTAACCGCGGACAAGAACTCGCTACAGACGGAG
AGGGTCAAACTACTCGGCGATGTGAGAATCGAGTCGGAGAGGAGGGAGATGCTACAGGGCAACTACGTCGCCCTA
CAGACCGAAAACGTGGAGCTGCAGAAGCGGAACCAGAGCCTCTCCGAGACGGCCGCCAAGCAGGACATTCGCACT
CAGCAGGTCGCGGAGGAGCTCGTCGAGGCCAGGGGCCTGGTGGACAGCATGAGGAACGAAACAGCAAACCTCAAG
GCCGAAAAGAAGCTCTGGAAAGACATCCAGGATCGGCTGAGCCGGGACAACGAGGGCCTGATCGAGGAGAAGAAC
CGGCTGAACAACCTGCTTGCTACGCAGCAAAACCTGGAGAACGAACGCAACATTTCCGAGGCCGAGACACGGCGC
AAGTCTCAGGAAAAGATCGACAAGCTCGAGCGGGAGCTGGACGAGGCCCAGCGGAAGCTGGCTCGCGAGGCCGAA
GAAATCAAGAGCCTCCAGCTCAGGAAGGAGTTTGAGGCTAGAGAGTCCCAAAAGCGGATTGATGAGCTCATGTCC
AGCTTGAGCCAAATCCGCGAAGAGCACGTCGGCGCCAAGACGACCCGAGATCACCTCCAGGCGCGCGTCGACGAG
CTCACCGTGGAGCTGCACAACGCCGAGGAGCGCGTCGGGCGGCTTCAACCGCGGTCTACCCCTCGACCCGGCCCG
ACTGCCGACAACAGCCACCAAGAGGAGCTCGAGGTCGAGATCCGAGATCTCCAAAACGAGATCTCCGACCTCAAA
CGGGACTTGGACCTGGCAAACACGAAGCTCGAGCATGCCAAGGTGTCGGCCGAGCAGTACAGGGAGCTCAGCCAG
AGCAACGAGGAGGCACTGGAAGATCTCCGCATCTCGCAGGACCAATACAGGCAGGAGATTGAGTCGCTAATGGGA
GAGAAGGATGCCAAGGTGAAGGAGCTGGACCAGCGCGTCAACGACGTATCCGCGGAGCTGTCGCGGTCTAACAAC
GAGCTGTCGACCCTGCGGGACGCCCAGAACGAGGTTTCGCGCCGATGCGACGACGAGAAGGTCATCCTCCAGGAA
GAGCTCAACCGCCTCAAGGAGGACAGCGCCCGGCACCTCGAAGCCGCACGCTACCACCAGCAGGACCTGCGCGCC
CAGGCCGAGATCGCATCCAAGGCGCAACAGGACTACGAGAAGGAGCTCGTCAAGCACGCCGAGGCGGCCAAGCTC
GTCCAGCAGCTGCGCTCCGAGCTGAACGGGCTCAAGAGTCAGACGGCGTCGCTGAGGACCGAGGCTGAATCCGCC
AAGGCCGCCCTGGTGCAGAATGAGGGCTCCTGGGACGAGCGGCGGCAGCAGCTGGAGCACGAGATGGCCGAGGTG
AAGGCCAGGCGAGAAGACGTCAACGCCCAGAACAAGCTGCTCCACCAGCAGCTCGAGGGACTGACTGCCCAGGTC
GCGGCCCTGCAGCAGAAGCGCGGCGGCGCCAACGAGGCCGACGACGAAGCCATGTCTCCCGTTGCGGTCGGGGAC
GCCCTCGACGGCCTCCGCGAGCTCAACAGCTACCTGCGTCGGGAGAAGGAGATCCTCGAGGTCCAGTACGACCTG
AAGTCGCAGGAGTCGAAGCGGCTACAGCAACAGATGGAGTACGTGCAGTCCCAGCTCGACGAGGCCCGCCTCAAG
CTGGACCAGGAACGGAGCCAAGCCGCCCAGGGCGGAGGCCGGAACTCGATGGCCCACCAGGAGCTCATGGACAAG
CTCAACGAGCTAAATCTGTACCGTGAGAGCAGTGCGGCCCTGCGGGCCGAGAACGCCCAGCTGAAAGAGCAGGTC
ATGGAGAGGAACAAGAAGGTCGAGGAGCTGGAGGGCAGGGTCCAGCCGCTCGAGGCTCAGATCGACAATCTCAAA
ACGTCCAAATCGTATTTGGAAGACGAAATCAAGCAAATTCAGGAAGACCGCGACCGCTGGCAAAAGCGGACGGAG
GGCATCCTGACAAAGTACGGCCGCGTCGACCCCGCCGAAATGGAGTCGCTCCGGCAGACAATAGAGGATTTGCAG
AAGGAGCGCGACACCCTCAAGGAGTCCGCCGGACCGCTGCAGGCCAGAGCCATCGAGCTGGAGTCGACACTCGAA
AGCGAGCGCGAAGGATGGCAAAATACCCGTGCGAAGCTCACGGAACAGTTCAAAGAGAGGTCAAAGAGGCTCACG
GGCGAGAAGAACGACTACATCCAGCGGTACAACCAGCTGCAGGAACAGCTGACCCAGGCCACCAGCGAGCTCGAG
GAGGCGCAGAAGCGCGCCGAGGACGCCGGACAGGAAAAGACGGAGCTCGAGAAGGAGGTCCAGAGCTTCAGGCAG
CAGGTACAGGAGCTGCGCCAGCAGGGACAACAGGCGCAGCAGGCGCCACAGGCGCAGCAGACCCAGTCCGCTTCG
GCCGAGGTGGTGGCCGAGCTGGAGAAGAGGCTCACCGACACCCGCAAGGAGCTGGAGGCGGTCACCGCGCAGAAA
CTAGGTGCCGAGCAGCAACTGGAGAATCTGCGGACGGAGCTGCAGGTTGCCGTCTCGGAACGCGAGCAGGCCCTG
CAGAAGCTGAAGGACGCGGCGGCCGCGCAGGCTGCCACGCAGGCCGACGCCGCCACTGAAACTGCGCAGCCGGCC
CCGACACCGCCGGCCCCCGAGGAACCTGTCGCGGTCCAGGAGGCTACTGCTGAAGCCCCGCCCGGCGGCACTCTT
TCGGACGAGGAGAGGAAAGCGCTGGAGGACAAGCTTGCAGCGGCCGAGGCTAAGGTGCTTGAGCTAGAGGACAAG
GTCAACCAGGCGCAACAGGCTTCCAAAGAGCGCTGCGACAAGATGCGCGATTCCTTGAACAACAAACTGAAAGAA
AGCCGAGTGAAATTCGAGGAGGAGGCCAAGCGGAGAGAAGAGGACCTCAAGCTCAGGTTCGAGCAGGAGAAGCGC
ATTTGGCAGGTCGAGAACCAGAACCCCAAGCCTGCGGCTCCGGAGCAGGCGCCATCAACGCCGGCCAAGGACGGC
CATGCTCCGCCGGCGCCGCCAGCCACGCCTGCCAAGGACGACCAGGCTCCGCCGGCGCCTGCCACGCCTGCCACG
GGCGGCACCCCCGACTTGGCGCAACTGGACGATACGAACATGCGGCAGTTCCTGGCTTCGAACCCGACTGTTAAG
AGCATCATCGCAGCCAACGTAAAGAAGAGGGTCGACGTCGAGCTGGCCAAGGCCAAGGGAGACACGGAAGCTAAG
ATATCTTCGGCCCGCGACCAAGCCCAACTCATGGAGTCAAAGAAGTCGACCTTGCGCATCAACATGGCCGAGAAC
AAGCTGAAGACGGCCAACACGAAACTGGGCATCGTCGAAACGGCCGCGACCGAGACGCCCCAGAAGCCAGTCGTC
GAGGTTTGGGAGGCCGTGAAGAAGGTGGGCCCCGCGGGAGCAGCCGCTCCGTCAACGCCGGCCAAACCGGCGCCC
GCGACGCCGGCACCGGCCAGCGAGCCCAAACAGCGCAGCAACGCCTCGACCCCTAAGCCCGCGGACCAGGCGGCA
GAAGCAGCCGCAGTGGACTCCACACCGGCAGAAGCCAAGCCGGAAGAAGTCAAGCCTGCGCAAGCCAAGCCGGCA
GAAGTCAAGCCTGCGCAAGCCAAGCCGGCGCCGTCATCGTTGCCGCAACACCCACCCTCGCTGCCACAGCTGCCC
CTTCCACCGCCGCCGCAGCAGGCACAGGGCGGTTCTCGGTCTTCGGGCATCCCGATGCCACGGGGCGGCGGCCGT
GGACGAGGAGGCGCGTACGTGCCACCAGGACAGCGAGCGGCCAGCGGGAACCAGGAGGGCGGACCCGGTCCCGCG
ACGCAGGGGGGGCGGGGAAGAGGCCGGGGCGGCGGTGGAGGTTTCAATCCCGGAGCGTCGGAGTTTCAGCCCGGG
ACCAAAAGACCGCGGGGCGAGTCGGAAGCGGGCAGGGGAGCGAAGAGGGCGCGGGGAGGCCAGTAG
Gene >Hirsu2|5850
ATGGCGGCTGCAGATGTCGATGTCGGCTACCTCGCGGGCCACCTCGGCCTCGATCAGCCCGTAGTGGCGGCGCTG
ACGACGGAGCCCACCGTCGACCTCGTGTCTACACTGCTGCGGGCTGTAGCGGTCAAGGCCCACGAGTTCGACACC
TTGTACGCCGAGAAGCTGCAGACCGACATCGAGCTCGAAAATGCCGTCCGCAGCGCCGAGTCGCGGTCCCAGACC
TCTAAGGCCACCGCCGAAAAGGCGCTGCACGATGTGCAGGAGGCCAGGCAAACACTGAAGGAAGAAGGTGCTTAC
CCCTCCTACGCGTTTCCCGCCATCGCTCGACACGGGCTGACCCTCCCTCTGATGCAGAGACGAAGCGCCAGTCTC
TCGAAAACGAGCTGCAGGTCCTGCGGGCCAAGAGCGACGATCACGCAGCCGAGGTCAAGACCCTCAACGACAAGA
TCGAGACGTTGCAATCCTCCAACCGCACCAACCTCAGCATCATCGAATCAAACACGAAACGCGACCAGACCGTCG
CCGACGAGCTGGCCAAGCAGCACCAGCGAAACGTCGAGCTCGCCCGTCAGGTCGCCTCCCTGCAGCAGTCCGAGC
AGAACGCCAAGGGTCAGGTTAACAGCGCCAAGTACCGCGAGGAGTCGCTCAAGCAGCAGCTCGACCTGGCCCTCC
GCAACACGGAATGGCTCGAGGGCGAGCTCAAGGCCAAGAGCGACGAGGCGCTTAAGTACAGGAAGGAAAAGGGCG
CCCGCATAGCCGAGCTGCAGAGAGAGAACGAGGACGCCAGGTCCCAGGTAGATGCCCTCAAGCGATCCGAGCAGC
AGTTCCGCGAACGCCTCGAGGCCATGCAGGCCAAGGCAGACGAGGCCCTCGTCAAGCTGCAGAAGCAGGAGGCCG
CCTTCGCCACCACCGTCGACAGCTACAAACAGGAGCTCGAGGACCAGCGCAGGCTCGTCGACATGTCCGACCAGT
TGAGCAAGAAGCACCAGGAGCGCGTGCGGGAGCTCGAGGCGGAGAGGGAGCGCCTCAAGGACAACTATGAGAACG
AGATCCGCCGGGTCCGCCTCGAGCTCGAGCAGGAGAGGCAAACCACGACGGAGATGGAGCACAAGATCCAGCAGC
TCGAGACCGACATCGACGAACTCCACGCCCGCATGGACAGGAGCGCCCACCTCCCCCCGCCCGGCTCGATGCCAC
AGACGCCGCGGCCCAACGGCTCCGTCATCGGCCGCGCCGCCTCGCCTTTTGGCACCCCGGGCTCCGTCCGCAGCA
AGTCGGCCGTCACCGCCACGCAAGCCATCGAGCAGCTATTCCAGGTCAAGGGCCAGCTCGCTAGCGAGAAGAGGC
GCAACCAGCAGCTCTCCGAGGAGCTTGACGGCGTCATCGCCGCCCTCGAGGCCAAGTCACCCGAGATCCTGGAGC
TTCAGGCCGAGAACGAAACCCTTCGGAATGAAATTACCCGTATGTCAGAGCTGTCCCAGCAGAGCTTCGAGGAGC
GAGACGTGGCGAGGAAGGCGGCGCGCAAGATGGAAAACGTCCTCAACGCCGCCCAGACCGAGACGAAGATCCTCA
AGATGCAGCTGCGCGACCTAGGGACCCAGATCCAGATGCTCGTCTTCAGCATCTACGCCTTCGAAAGGGGCATCG
ACCAGCTGACGGAAGAGGAGAAGTTCCGCCTGCAGCAGCTGGAAAAGGGAGAGGTCACGGAGGAGGCCCTGTCCG
ATATGTCCGATACGCACCAGTTTGTCACGCAGAAGCTGGTCGTCTTCAAGGATATCAAGTCTCTGCAGGCCAAGA
ACGAGTATCTGATGCGCATCACCCGGGAGCTTGCTGAGCAGATGGAGAGCGAGGAGGCCCTCGCCGCGAAGCACC
AGGCCAAGCTGGACCACGACCAGGTAGAAACGCTCCAGCGGGAGCTGCAACACGTGCTCGAGGAGAGCAGATCCC
ACAAGATCACCACGGAGAGCTACAAGGCCGAACGCGACATGTTCCGACGCATCCTGCAGCAGCGAGGCGCCGGCG
GGGACGAGGCGTCCATGATGCGGAGCTCCCTCGACGGATCTCAGCGGCCCCCGCTCGTTAGCATCGAGGGCGACC
AGTCTGAGGCTCTCAACGAAGCGCTGCGGAAGCTCCAGTCCGAGTACGACAGCTTCAGGGACGCCCAGAACGACG
TCCGCAAAGACCTCCGCGACCAGATCGACCACCTAACCGCGGACAAGAACTCGCTACAGACGGAGAGGGTCAAAC
TACTCGGCGATGTGAGAATCGAGTCGGAGAGGAGGGAGATGCTACAGGGCAACTACGTCGCCCTACAGACCGAAA
ACGTGGAGCTGCAGAAGCGGAACCAGAGCCTCTCCGAGACGGCCGCCAAGCAGGACATTCGCACTCAGCAGGTCG
CGGAGGAGCTCGTCGAGGCCAGGGGCCTGGTGGACAGCATGAGGAACGAAACAGCAAACCTCAAGGCCGAAAAGA
AGCTCTGGAAAGACATCCAGGATCGGCTGAGCCGGGACAACGAGGGCCTGATCGAGGAGAAGAACCGGCTGAACA
ACCTGCTTGCTACGCAGCAAAACCTGGAGAACGAACGCAACATTTCCGAGGCCGAGACACGGCGCAAGTCTCAGG
AAAAGATCGACAAGCTCGAGCGGGAGCTGGACGAGGCCCAGCGGAAGCTGGCTCGCGAGGCCGAAGAAATCAAGA
GCCTCCAGCTCAGGAAGGAGTTTGAGGCTAGAGAGTCCCAAAAGCGGATTGATGAGCTCATGTCCAGCTTGAGCC
AAATCCGCGAAGAGCACGTCGGCGCCAAGACGACCCGAGATCACCTCCAGGCGCGCGTCGACGAGCTCACCGTGG
AGCTGCACAACGCCGAGGAGCGCGTCGGGCGGCTTCAACCGCGGTCTACCCCTCGACCCGGCCCGACTGCCGACA
ACAGCCACCAAGAGGAGCTCGAGGTCGAGATCCGAGATCTCCAAAACGAGATCTCCGACCTCAAACGGGACTTGG
ACCTGGCAAACACGAAGCTCGAGCATGCCAAGGTGTCGGCCGAGCAGTACAGGGAGCTCAGCCAGAGCAACGAGG
AGGCACTGGAAGATCTCCGCATCTCGCAGGACCAATACAGGCAGGAGATTGAGTCGCTAATGGGAGAGAAGGATG
CCAAGGTGAAGGAGCTGGACCAGCGCGTCAACGACGTATCCGCGGAGCTGTCGCGGTCTAACAACGAGCTGTCGA
CCCTGCGGGACGCCCAGAACGAGGTTTCGCGCCGATGCGACGACGAGAAGGTCATCCTCCAGGAAGAGCTCAACC
GCCTCAAGGAGGACAGCGCCCGGCACCTCGAAGCCGCACGCTACCACCAGCAGGACCTGCGCGCCCAGGCCGAGA
TCGCATCCAAGGCGCAACAGGACTACGAGAAGGAGCTCGTCAAGCACGCCGAGGCGGCCAAGCTCGTCCAGCAGC
TGCGCTCCGAGCTGAACGGGCTCAAGAGTCAGACGGCGTCGCTGAGGACCGAGGCTGAATCCGCCAAGGCCGCCC
TGGTGCAGAATGAGGGCTCCTGGGACGAGCGGCGGCAGCAGCTGGAGCACGAGATGGCCGAGGTGAAGGCCAGGC
GAGAAGACGTCAACGCCCAGAACAAGCTGCTCCACCAGCAGCTCGAGGGACTGACTGCCCAGGTCGCGGCCCTGC
AGCAGAAGCGCGGCGGCGCCAACGAGGCCGACGACGAAGCCATGTCTCCCGTTGCGGTCGGGGACGCCCTCGACG
GCCTCCGCGAGCTCAACAGCTACCTGCGTCGGGAGAAGGAGATCCTCGAGGTCCAGTACGACCTGAAGTCGCAGG
AGTCGAAGCGGCTACAGCAACAGATGGAGTACGTGCAGTCCCAGCTCGACGAGGCCCGCCTCAAGCTGGACCAGG
AACGGAGCCAAGCCGCCCAGGGCGGAGGCCGGAACTCGATGGCCCACCAGGAGCTCATGGACAAGCTCAACGAGC
TAAATCTGTACCGTGAGAGCAGTGCGGCCCTGCGGGCCGAGAACGCCCAGCTGAAAGAGCAGGTCATGGAGAGGA
ACAAGAAGGTCGAGGAGCTGGAGGGCAGGGTCCAGCCGCTCGAGGCTCAGATCGACAATCTCAAAACGTCCAAAT
CGTATTTGGAAGACGAAATCAAGCAAATTCAGGAAGACCGCGACCGCTGGCAAAAGCGGACGGAGGGCATCCTGA
CAAAGTACGGCCGCGTCGACCCCGCCGAAATGGAGTCGCTCCGGCAGACAATAGAGGATTTGCAGAAGGAGCGCG
ACACCCTCAAGGAGTCCGCCGGACCGCTGCAGGCCAGAGCCATCGAGCTGGAGTCGACACTCGAAAGCGAGCGCG
AAGGATGGCAAAATACCCGTGCGAAGCTCACGGAACAGTTCAAAGAGAGGTCAAAGAGGCTCACGGGCGAGAAGA
ACGACTACATCCAGCGGTACAACCAGCTGCAGGAACAGCTGACCCAGGCCACCAGCGAGCTCGAGGAGGCGCAGA
AGCGCGCCGAGGACGCCGGACAGGAAAAGACGGAGCTCGAGAAGGAGGTCCAGAGCTTCAGGCAGCAGGTACAGG
AGCTGCGCCAGCAGGGACAACAGGCGCAGCAGGCGCCACAGGCGCAGCAGACCCAGTCCGCTTCGGCCGAGGTGG
TGGCCGAGCTGGAGAAGAGGCTCACCGACACCCGCAAGGAGCTGGAGGCGGTCACCGCGCAGAAACTAGGTGCCG
AGCAGCAACTGGAGAATCTGCGGACGGAGCTGCAGGTTGCCGTCTCGGAACGCGAGCAGGCCCTGCAGAAGCTGA
AGGACGCGGCGGCCGCGCAGGCTGCCACGCAGGCCGACGCCGCCACTGAAACTGCGCAGCCGGCCCCGACACCGC
CGGCCCCCGAGGAACCTGTCGCGGTCCAGGAGGCTACTGCTGAAGCCCCGCCCGGCGGCACTCTTTCGGACGAGG
AGAGGAAAGCGCTGGAGGACAAGCTTGCAGCGGCCGAGGCTAAGGTGCTTGAGCTAGAGGACAAGGTCAACCAGG
CGCAACAGGCTTCCAAAGAGCGCTGCGACAAGATGCGCGATTCCTTGAACAACAAACTGAAAGAAAGCCGAGTGA
AATTCGAGGAGGAGGCCAAGCGGAGAGAAGAGGACCTCAAGCTCAGGTTCGAGCAGGAGAAGCGCATTTGGCAGG
TCGAGAACCAGAACCCCAAGCCTGCGGCTCCGGAGCAGGCGCCATCAACGCCGGCCAAGGACGGCCATGCTCCGC
CGGCGCCGCCAGCCACGCCTGCCAAGGACGACCAGGCTCCGCCGGCGCCTGCCACGCCTGCCACGGGCGGCACCC
CCGACTTGGCGCAACTGGACGATACGAACATGCGGCAGTTCCTGGCTTCGAACCCGACTGTTAAGAGCATCATCG
CAGCCAACGTAAAGAAGAGGGTCGACGTCGAGCTGGCCAAGGCCAAGGGAGACACGGAAGCTAAGATATCTTCGG
CCCGCGACCAAGCCCAACTCATGGAGTCAAAGAAGTCGACCTTGCGCATCAACATGGCCGAGAACAAGCTGAAGA
CGGCCAACACGAAACTGGGCATCGTCGAAACGGCCGCGACCGAGACGCCCCAGAAGCCAGTCGTCGAGGTTTGGG
AGGCCGTGAAGAAGGTGGGCCCCGCGGGAGCAGCCGCTCCGTCAACGCCGGCCAAACCGGCGCCCGCGACGCCGG
CACCGGCCAGCGAGCCCAAACAGCGCAGCAACGCCTCGACCCCTAAGCCCGCGGACCAGGCGGCAGAAGCAGCCG
CAGTGGACTCCACACCGGCAGAAGCCAAGCCGGAAGAAGTCAAGCCTGCGCAAGCCAAGCCGGCAGAAGTCAAGC
CTGCGCAAGCCAAGCCGGCGCCGTCATCGTTGCCGCAACACCCACCCTCGCTGCCACAGCTGCCCCTTCCACCGC
CGCCGCAGCAGGCACAGGGCGGTTCTCGGTCTTCGGGCATCCCGATGCCACGGGGCGGCGGCCGTGGACGAGGAG
GCGCGTACGTGCCACCAGGACAGCGAGCGGCCAGCGGGAACCAGGAGGGCGGACCCGGTCCCGCGACGCAGGGGG
GGCGGGGAAGAGGCCGGGGCGGCGGTGGAGGTTTCAATCCCGGAGCGTCGGAGTTTCAGCCCGGGACCAAAAGAC
CGCGGGGCGAGTCGGAAGCGGGCAGGGGAGCGAAGAGGGCGCGGGGAGGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail