Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5849
Gene name
LocationContig_296:577..3016
Strand-
Gene length (bp)2439
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 3.9E-40 219 417
PF00271 Helicase_C Helicase conserved C-terminal domain 1.1E-25 476 583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS2|MAK5_GIBZE ATP-dependent RNA helicase MAK5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MAK5 PE=3 SV=2 1 767 0.0E+00
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 3 767 0.0E+00
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 1 767 0.0E+00
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 6 767 0.0E+00
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 50 767 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS2|MAK5_GIBZE ATP-dependent RNA helicase MAK5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MAK5 PE=3 SV=2 1 767 0.0E+00
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 3 767 0.0E+00
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 1 767 0.0E+00
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 6 767 0.0E+00
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 50 767 0.0E+00
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 39 746 0.0E+00
sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 21 759 0.0E+00
sp|Q4WMS3|MAK5_ASPFU ATP-dependent RNA helicase mak5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mak5 PE=3 SV=2 177 759 0.0E+00
sp|A1CTL8|MAK5_ASPCL ATP-dependent RNA helicase mak5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mak5 PE=3 SV=1 177 759 0.0E+00
sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 177 765 0.0E+00
sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 39 762 0.0E+00
sp|Q5BCI0|MAK5_EMENI ATP-dependent RNA helicase mak5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mak5 PE=3 SV=1 194 765 0.0E+00
sp|Q1E7Y4|MAK5_COCIM ATP-dependent RNA helicase MAK5 OS=Coccidioides immitis (strain RS) GN=MAK5 PE=3 SV=1 29 759 0.0E+00
sp|A2QWW0|MAK5_ASPNC ATP-dependent RNA helicase mak5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mak5 PE=3 SV=1 39 762 4.0E-178
sp|A7TEG8|MAK5_VANPO ATP-dependent RNA helicase MAK5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MAK5 PE=3 SV=1 56 751 2.0E-127
sp|O74393|MAK5_SCHPO ATP-dependent RNA helicase mak5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak5 PE=1 SV=1 96 746 4.0E-125
sp|P38112|MAK5_YEAST ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK5 PE=1 SV=1 176 756 1.0E-124
sp|A6ZL85|MAK5_YEAS7 ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAK5 PE=3 SV=1 19 756 2.0E-124
sp|Q6CTN7|MAK5_KLULA ATP-dependent RNA helicase MAK5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MAK5 PE=3 SV=1 4 756 2.0E-120
sp|A5DUB2|MAK5_LODEL ATP-dependent RNA helicase MAK5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAK5 PE=3 SV=1 176 746 6.0E-120
sp|Q6FY67|MAK5_CANGA ATP-dependent RNA helicase MAK5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAK5 PE=3 SV=1 174 756 5.0E-118
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 177 738 1.0E-115
sp|Q6BV58|MAK5_DEBHA ATP-dependent RNA helicase MAK5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAK5 PE=3 SV=1 19 738 4.0E-114
sp|Q757I6|MAK5_ASHGO ATP-dependent RNA helicase MAK5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAK5 PE=3 SV=1 197 756 4.0E-114
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 191 738 3.0E-112
sp|A3GG51|MAK5_PICST ATP-dependent RNA helicase MAK5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MAK5 PE=3 SV=2 200 738 6.0E-111
sp|P0CQ91|MAK5_CRYNB ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MAK5 PE=3 SV=1 194 747 2.0E-94
sp|P0CQ90|MAK5_CRYNJ ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MAK5 PE=3 SV=1 194 747 3.0E-94
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 190 740 5.0E-93
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 190 740 5.0E-93
sp|Q93Y39|RH13_ARATH DEAD-box ATP-dependent RNA helicase 13 OS=Arabidopsis thaliana GN=RH13 PE=2 SV=3 197 671 6.0E-81
sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1 219 724 4.0E-75
sp|Q5RDL2|DDX24_PONAB ATP-dependent RNA helicase DDX24 OS=Pongo abelii GN=DDX24 PE=2 SV=1 265 724 1.0E-74
sp|Q9ESV0|DDX24_MOUSE ATP-dependent RNA helicase DDX24 OS=Mus musculus GN=Ddx24 PE=1 SV=2 262 664 6.0E-69
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 199 604 7.0E-56
sp|Q54TD7|DDX24_DICDI ATP-dependent RNA helicase ddx24 OS=Dictyostelium discoideum GN=ddx24 PE=3 SV=1 403 740 1.0E-54
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 189 598 1.0E-54
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 213 611 2.0E-54
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 196 598 1.0E-53
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 200 594 3.0E-53
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 200 594 4.0E-53
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 206 604 8.0E-53
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 195 599 1.0E-52
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 206 604 2.0E-52
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 200 598 3.0E-52
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 206 604 6.0E-52
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 186 592 8.0E-52
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 197 608 8.0E-52
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 197 590 2.0E-51
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 197 608 3.0E-51
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 193 593 4.0E-51
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 186 590 5.0E-51
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 197 592 9.0E-51
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 181 593 1.0E-50
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 186 594 1.0E-50
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 193 593 2.0E-50
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 202 594 2.0E-50
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 196 608 2.0E-50
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 206 591 3.0E-50
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 197 590 3.0E-50
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 197 590 3.0E-50
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 181 593 5.0E-50
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 197 594 8.0E-50
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 197 594 2.0E-49
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 193 593 2.0E-49
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 199 593 2.0E-49
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 197 594 3.0E-49
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 192 598 3.0E-49
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 200 594 4.0E-49
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 192 646 4.0E-49
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 200 598 4.0E-49
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 180 608 8.0E-49
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 176 660 8.0E-49
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 200 652 9.0E-49
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 205 598 9.0E-49
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 194 597 1.0E-48
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 188 606 1.0E-48
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 174 593 1.0E-48
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 199 592 1.0E-48
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 200 690 1.0E-48
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 197 598 1.0E-48
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 182 594 2.0E-48
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 191 593 2.0E-48
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 200 608 2.0E-48
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 200 608 2.0E-48
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 200 594 3.0E-48
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 205 598 4.0E-48
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 206 611 4.0E-48
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 194 598 4.0E-48
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 194 598 4.0E-48
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 206 594 4.0E-48
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 214 594 5.0E-48
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 206 626 5.0E-48
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 213 648 5.0E-48
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 197 598 6.0E-48
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 200 598 8.0E-48
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 188 597 1.0E-47
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 213 648 1.0E-47
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 194 598 1.0E-47
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 200 594 1.0E-47
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 195 593 1.0E-47
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 205 598 2.0E-47
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 200 598 2.0E-47
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 197 598 3.0E-47
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 207 608 3.0E-47
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 202 589 3.0E-47
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 206 598 3.0E-47
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 200 608 4.0E-47
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 196 609 4.0E-47
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 195 598 4.0E-47
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 200 598 6.0E-47
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 191 598 6.0E-47
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 197 598 6.0E-47
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 197 598 6.0E-47
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 205 598 6.0E-47
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 200 606 9.0E-47
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 194 589 1.0E-46
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 171 589 1.0E-46
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 196 593 1.0E-46
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 196 593 1.0E-46
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 176 593 2.0E-46
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 207 690 2.0E-46
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 193 608 2.0E-46
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 200 593 2.0E-46
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 206 648 3.0E-46
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 206 608 3.0E-46
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 202 589 3.0E-46
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 185 593 3.0E-46
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 139 594 3.0E-46
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 205 598 4.0E-46
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 209 598 5.0E-46
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 197 598 7.0E-46
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 178 596 7.0E-46
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 194 598 7.0E-46
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 207 604 8.0E-46
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 202 606 9.0E-46
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 185 608 9.0E-46
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 194 594 9.0E-46
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 182 598 9.0E-46
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 194 594 1.0E-45
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 194 598 1.0E-45
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 194 594 1.0E-45
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 197 590 1.0E-45
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 202 589 1.0E-45
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 197 598 2.0E-45
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 194 594 2.0E-45
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 197 608 2.0E-45
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 202 589 2.0E-45
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 202 589 2.0E-45
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 197 593 2.0E-45
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 202 589 2.0E-45
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 197 598 3.0E-45
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 200 594 3.0E-45
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 197 598 3.0E-45
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 215 594 4.0E-45
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 195 592 4.0E-45
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 148 594 4.0E-45
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 213 587 5.0E-45
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 194 589 5.0E-45
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 184 594 6.0E-45
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 194 589 7.0E-45
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 200 597 8.0E-45
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 126 590 8.0E-45
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 194 594 9.0E-45
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 202 606 1.0E-44
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 139 594 1.0E-44
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 148 594 1.0E-44
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 184 597 1.0E-44
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 200 608 1.0E-44
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 193 596 1.0E-44
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 214 594 1.0E-44
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 197 630 1.0E-44
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 207 604 2.0E-44
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 194 598 2.0E-44
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 194 597 2.0E-44
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 194 589 2.0E-44
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 200 602 2.0E-44
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 215 594 2.0E-44
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 194 597 3.0E-44
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 200 613 3.0E-44
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 197 594 3.0E-44
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 206 648 3.0E-44
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 200 598 4.0E-44
sp|Q9DF36|DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis GN=ddx21-b PE=2 SV=2 196 597 4.0E-44
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 189 597 4.0E-44
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 197 610 5.0E-44
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 189 607 6.0E-44
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 194 604 6.0E-44
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 197 627 7.0E-44
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 194 599 7.0E-44
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 194 698 1.0E-43
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 197 630 1.0E-43
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 207 608 1.0E-43
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 194 701 1.0E-43
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 194 604 1.0E-43
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 194 589 1.0E-43
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 196 627 1.0E-43
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 194 701 1.0E-43
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 200 597 2.0E-43
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 194 662 2.0E-43
sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 200 598 2.0E-43
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 206 604 2.0E-43
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 202 594 2.0E-43
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 199 597 2.0E-43
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 202 594 2.0E-43
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 200 597 2.0E-43
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 200 627 2.0E-43
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 193 587 3.0E-43
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 200 597 3.0E-43
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 184 597 5.0E-43
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 184 597 5.0E-43
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 184 597 5.0E-43
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 200 598 5.0E-43
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 215 597 5.0E-43
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 200 597 6.0E-43
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 194 720 6.0E-43
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 209 598 6.0E-43
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 194 591 7.0E-43
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 197 598 7.0E-43
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 194 597 7.0E-43
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 194 598 7.0E-43
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 194 604 7.0E-43
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 194 604 7.0E-43
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 194 604 7.0E-43
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 194 604 1.0E-42
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 194 623 1.0E-42
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 197 669 1.0E-42
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 200 590 1.0E-42
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 210 594 1.0E-42
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 195 597 1.0E-42
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 190 591 1.0E-42
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 202 589 1.0E-42
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 194 589 1.0E-42
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 202 594 1.0E-42
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 174 597 1.0E-42
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 200 677 1.0E-42
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 174 597 1.0E-42
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 194 597 1.0E-42
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 200 608 2.0E-42
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 194 662 2.0E-42
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 200 598 2.0E-42
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 197 593 2.0E-42
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 210 605 2.0E-42
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 206 598 2.0E-42
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 202 589 2.0E-42
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 194 597 2.0E-42
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 196 582 2.0E-42
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 167 623 3.0E-42
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 200 597 3.0E-42
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 200 597 3.0E-42
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 195 598 3.0E-42
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 195 598 3.0E-42
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 197 598 3.0E-42
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 197 598 3.0E-42
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 190 605 4.0E-42
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 194 597 4.0E-42
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 200 596 4.0E-42
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 200 597 5.0E-42
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 194 616 5.0E-42
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 200 623 5.0E-42
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 188 589 5.0E-42
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 200 597 6.0E-42
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 200 597 7.0E-42
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 202 594 7.0E-42
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 194 597 7.0E-42
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 185 597 7.0E-42
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 194 594 8.0E-42
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 201 590 8.0E-42
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 202 589 1.0E-41
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 191 676 1.0E-41
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 215 594 1.0E-41
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 200 619 1.0E-41
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 197 614 1.0E-41
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 194 597 1.0E-41
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 200 597 1.0E-41
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 197 598 1.0E-41
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 210 589 1.0E-41
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 176 596 2.0E-41
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 201 596 2.0E-41
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 193 627 2.0E-41
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 193 627 2.0E-41
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 200 596 2.0E-41
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 197 598 2.0E-41
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 194 611 2.0E-41
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 194 662 2.0E-41
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 201 590 2.0E-41
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 192 604 2.0E-41
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 202 589 2.0E-41
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 200 623 2.0E-41
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 210 605 2.0E-41
sp|P21372|PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP5 PE=1 SV=1 194 627 2.0E-41
sp|A6ZLH6|PRP5_YEAS7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRP5 PE=3 SV=1 194 627 3.0E-41
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 200 597 3.0E-41
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 194 597 3.0E-41
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 193 589 3.0E-41
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 202 597 3.0E-41
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 199 709 3.0E-41
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 209 598 4.0E-41
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 197 627 4.0E-41
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 184 607 4.0E-41
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 200 597 4.0E-41
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 194 597 4.0E-41
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 201 590 5.0E-41
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 200 596 5.0E-41
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 195 594 5.0E-41
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 200 623 5.0E-41
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 200 597 5.0E-41
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 174 597 6.0E-41
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 210 589 6.0E-41
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 184 590 6.0E-41
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 200 596 6.0E-41
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 200 607 6.0E-41
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 201 590 8.0E-41
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 197 590 9.0E-41
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 192 597 1.0E-40
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 200 596 1.0E-40
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 201 597 1.0E-40
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 194 597 2.0E-40
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 201 596 2.0E-40
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 215 597 2.0E-40
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 188 589 2.0E-40
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 194 597 2.0E-40
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 201 590 2.0E-40
sp|Q6FML5|PRP5_CANGA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP5 PE=3 SV=1 194 598 3.0E-40
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 194 597 3.0E-40
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 205 598 4.0E-40
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 215 595 4.0E-40
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 194 597 4.0E-40
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 194 653 4.0E-40
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 194 597 4.0E-40
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 194 597 4.0E-40
sp|Q6FU81|MS116_CANGA ATP-dependent RNA helicase MSS116, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MSS116 PE=3 SV=1 179 598 4.0E-40
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 195 593 4.0E-40
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 195 593 4.0E-40
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 202 595 4.0E-40
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 184 597 5.0E-40
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 184 597 5.0E-40
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 202 584 6.0E-40
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 200 597 6.0E-40
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 192 590 6.0E-40
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 197 590 6.0E-40
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 200 597 7.0E-40
sp|Q6CT46|DBP3_KLULA ATP-dependent RNA helicase DBP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP3 PE=3 SV=1 175 597 7.0E-40
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 197 590 8.0E-40
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 197 590 8.0E-40
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 197 590 8.0E-40
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 202 683 8.0E-40
sp|Q9DF35|DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis GN=ddx21-a PE=2 SV=2 186 597 8.0E-40
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 196 582 8.0E-40
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 186 597 9.0E-40
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 197 590 1.0E-39
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 194 594 1.0E-39
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 206 604 1.0E-39
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 197 598 1.0E-39
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 197 614 1.0E-39
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 194 604 1.0E-39
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 194 597 1.0E-39
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 192 608 2.0E-39
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 206 604 2.0E-39
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 194 604 2.0E-39
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 206 625 2.0E-39
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 206 590 2.0E-39
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 215 594 2.0E-39
sp|Q8SR01|DBP4_ENCCU ATP-dependent RNA helicase DBP4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP4 PE=3 SV=2 200 591 2.0E-39
sp|A3LX02|SPB4_PICST ATP-dependent rRNA helicase SPB4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SPB4 PE=3 SV=2 196 594 2.0E-39
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 184 590 2.0E-39
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 194 597 2.0E-39
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 189 593 2.0E-39
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 194 597 2.0E-39
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 206 604 3.0E-39
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 184 590 3.0E-39
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 194 597 3.0E-39
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 194 597 3.0E-39
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 194 597 3.0E-39
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 200 596 3.0E-39
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 202 604 3.0E-39
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 206 604 4.0E-39
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 206 625 4.0E-39
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 206 623 4.0E-39
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 214 597 5.0E-39
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 187 590 5.0E-39
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 194 604 5.0E-39
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 202 592 6.0E-39
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 189 597 6.0E-39
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 215 597 6.0E-39
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 200 611 8.0E-39
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 194 598 8.0E-39
sp|P90897|RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans GN=rde-12 PE=1 SV=4 189 595 8.0E-39
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 187 627 9.0E-39
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 210 611 9.0E-39
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 194 598 1.0E-38
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 194 620 1.0E-38
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 194 598 1.0E-38
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 184 590 1.0E-38
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 196 623 1.0E-38
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 197 593 1.0E-38
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 184 590 1.0E-38
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 184 590 1.0E-38
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 197 593 1.0E-38
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 194 598 1.0E-38
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 206 625 1.0E-38
sp|Q6ZPL9|DDX55_MOUSE ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=1 SV=2 184 634 1.0E-38
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 187 590 1.0E-38
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 187 590 1.0E-38
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 199 600 1.0E-38
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 197 597 2.0E-38
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 194 597 2.0E-38
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 206 604 2.0E-38
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 185 611 2.0E-38
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 206 597 2.0E-38
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 197 593 2.0E-38
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 184 590 2.0E-38
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 193 592 2.0E-38
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 192 595 2.0E-38
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 213 597 2.0E-38
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 201 596 2.0E-38
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 128 593 2.0E-38
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 192 594 2.0E-38
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 196 590 2.0E-38
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 192 597 3.0E-38
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 194 597 3.0E-38
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 199 604 3.0E-38
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 196 590 3.0E-38
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 199 604 3.0E-38
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 200 598 3.0E-38
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 202 590 3.0E-38
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 202 590 3.0E-38
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 202 590 3.0E-38
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 206 587 4.0E-38
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 204 597 4.0E-38
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 199 590 4.0E-38
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 197 593 4.0E-38
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 196 604 5.0E-38
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 196 604 5.0E-38
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 200 597 6.0E-38
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 204 597 6.0E-38
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 197 593 6.0E-38
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 200 684 6.0E-38
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 204 597 6.0E-38
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 214 593 6.0E-38
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 197 598 6.0E-38
sp|Q5ANB2|DBP10_CANAL ATP-dependent RNA helicase DBP10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP10 PE=3 SV=1 197 598 7.0E-38
sp|A5UI36|RHLB_HAEIG ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittGG) GN=rhlB PE=3 SV=1 197 599 8.0E-38
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 202 592 8.0E-38
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 215 594 8.0E-38
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 197 611 8.0E-38
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 194 598 9.0E-38
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 206 625 9.0E-38
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 187 590 9.0E-38
sp|A5DDF4|PRP5_PICGU Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP5 PE=3 SV=2 194 593 9.0E-38
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 200 684 1.0E-37
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 200 684 1.0E-37
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 200 684 1.0E-37
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 200 684 1.0E-37
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 184 590 1.0E-37
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 197 593 1.0E-37
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 194 597 1.0E-37
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 200 684 1.0E-37
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 206 624 1.0E-37
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 194 593 1.0E-37
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 206 606 2.0E-37
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 192 595 2.0E-37
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 194 597 2.0E-37
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 183 602 2.0E-37
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 138 592 2.0E-37
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 196 598 2.0E-37
sp|P0CQ79|DBP3_CRYNB ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP3 PE=3 SV=1 215 594 2.0E-37
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 197 593 2.0E-37
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 197 598 2.0E-37
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 206 590 3.0E-37
sp|Q6AZV7|DDX55_XENLA ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1 191 597 3.0E-37
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 214 594 3.0E-37
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 200 592 3.0E-37
sp|A8GZJ0|RHLB_SHEPA ATP-dependent RNA helicase RhlB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rhlB PE=3 SV=1 184 590 3.0E-37
sp|P0CQ78|DBP3_CRYNJ ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP3 PE=3 SV=1 215 594 3.0E-37
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 197 593 4.0E-37
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 197 593 4.0E-37
sp|Q4PEX7|DBP8_USTMA ATP-dependent RNA helicase DBP8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP8 PE=3 SV=2 197 598 4.0E-37
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 197 593 4.0E-37
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 194 597 5.0E-37
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 206 605 5.0E-37
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 200 597 5.0E-37
sp|Q9CJS1|RHLB_PASMU ATP-dependent RNA helicase RhlB OS=Pasteurella multocida (strain Pm70) GN=rhlB PE=3 SV=1 200 599 5.0E-37
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 204 605 5.0E-37
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 200 597 5.0E-37
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 194 597 5.0E-37
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 202 599 6.0E-37
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 202 597 6.0E-37
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 200 590 6.0E-37
sp|Q5ZLN8|DDX55_CHICK ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1 184 597 6.0E-37
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 191 598 6.0E-37
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 202 597 7.0E-37
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 206 592 7.0E-37
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 197 593 7.0E-37
sp|A3LZT3|DBP10_PICST ATP-dependent RNA helicase DBP10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP10 PE=3 SV=2 202 598 7.0E-37
sp|Q54TD7|DDX24_DICDI ATP-dependent RNA helicase ddx24 OS=Dictyostelium discoideum GN=ddx24 PE=3 SV=1 184 388 8.0E-32
sp|Q9ESV0|DDX24_MOUSE ATP-dependent RNA helicase DDX24 OS=Mus musculus GN=Ddx24 PE=1 SV=2 184 259 6.0E-09
sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1 184 259 5.0E-08
sp|Q5RDL2|DDX24_PONAB ATP-dependent RNA helicase DDX24 OS=Pongo abelii GN=DDX24 PE=2 SV=1 184 259 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5849
MTSSSKKRKLLAAVGPAPKRSKSQTGKTATSKSAGKKPVPQRIVDASALAWRQFDEEFGGLEVVSGVSVVKNGDQ
VQFTQRESDKDDGGGASSQEPDEESFEGFGDDAVEGQDVGPGQAGCPQASVGSPEGQEKAADKGKGKPKKKGPQQ
KGGQATVAAAAAEGLLPKAGKHGGSNSFGALADMSEVGEGNVDVADWVALKLSPRILSAIARLGFARPTAIQKMA
IPEIIAGEDVIGKAQTGSGKTLSFGIPIVERWLETREDGQEELDDDGAAAAAAREAAPLALVLSPTRELAKQLGD
HLKALCDDLAAAPYVCVVTGGLSVQKQQRQLAKADIVIGTPGRLWELMDGDAKLQETLTRIRFLVVDEADRLFTA
GQFQEAQDIIGALDRRDPDGDAAPPTPRQTLIFSATFDKNLQTKLAGRGRTATTAGVEDKMAYLIKCLHFRREPK
FLDANPVTQMAERLREGLIECGAMEKDLYLYTVLLLNPGRRTLVFTNSISAVRRLTPLLQNLKLEVLPLHSQMAQ
KARLRSLERFAELPSSILVATDVAARGLDIHEVDQVLHYHVPRTADTYVHRSGRTARGEHSGVSIILCSPDEVMP
TRRLAAKVHAERRSAGDSRQQHMIQALPVDRKIASRLRPRVELSKRLADAVLAKEKAGSDDAWLRAAAEELGVEY
DADEFESAAAGGSWGGRGGGRKRKEKEARALSKAEMGALRAQLREELGRRVNLGVSERYITGGRVDVGALLRERN
GAPGAVFLGGDDLGLGLL*
Coding >Hirsu2|5849
ATGACCTCTTCTTCAAAGAAGCGCAAGCTTCTCGCAGCCGTCGGACCGGCGCCGAAGCGCAGCAAGAGCCAGACC
GGGAAGACGGCGACTTCGAAATCCGCGGGCAAGAAGCCGGTCCCGCAGCGCATCGTCGACGCGTCCGCGCTCGCC
TGGAGACAGTTCGACGAGGAGTTTGGCGGATTGGAGGTAGTCAGCGGCGTCAGTGTCGTCAAGAACGGAGACCAG
GTGCAGTTCACGCAGAGGGAGTCGGACAAAGACGACGGCGGGGGCGCCAGTTCGCAAGAGCCAGATGAGGAGTCT
TTTGAAGGGTTTGGCGACGACGCTGTGGAGGGCCAAGATGTCGGTCCCGGCCAAGCTGGCTGCCCTCAAGCTTCT
GTGGGGAGCCCGGAGGGTCAAGAAAAGGCTGCAGACAAGGGCAAGGGTAAGCCGAAGAAGAAGGGCCCGCAGCAG
AAGGGCGGCCAGGCAACCGTCGCGGCGGCAGCAGCTGAAGGACTTCTTCCAAAGGCCGGCAAGCACGGCGGCAGT
AACTCCTTCGGCGCGCTCGCGGACATGTCAGAGGTCGGAGAGGGCAACGTCGACGTGGCGGACTGGGTGGCGCTG
AAGCTGTCGCCGCGCATCCTGTCGGCGATCGCGCGCCTCGGCTTTGCGAGGCCGACGGCGATCCAGAAGATGGCG
ATTCCGGAGATCATCGCGGGTGAGGACGTCATCGGCAAGGCGCAGACGGGGTCCGGCAAGACGCTGTCGTTTGGG
ATCCCAATCGTCGAGCGCTGGCTCGAGACGCGTGAGGACGGACAAGAGGAGTTGGACGACGACGGAGCAGCTGCC
GCCGCCGCGCGCGAGGCGGCTCCCCTGGCGCTGGTGCTGAGTCCGACGCGCGAGCTGGCCAAGCAGCTGGGCGAC
CACCTCAAGGCGCTGTGCGACGACCTCGCGGCCGCGCCCTACGTCTGCGTCGTCACCGGCGGCCTCAGCGTCCAG
AAGCAGCAGCGGCAGCTGGCCAAGGCCGACATCGTCATCGGGACGCCCGGCCGGCTGTGGGAGCTGATGGACGGG
GACGCCAAGCTGCAGGAGACGCTGACGCGCATCCGCTTCCTCGTCGTCGACGAGGCCGACCGCCTCTTCACCGCC
GGCCAGTTCCAGGAGGCCCAGGACATCATCGGCGCCCTGGACCGTCGCGACCCCGACGGGGACGCCGCGCCGCCC
ACGCCGCGCCAAACACTCATCTTCTCCGCTACCTTCGACAAGAACCTCCAGACGAAGCTCGCCGGCAGGGGCAGG
ACCGCAACCACCGCCGGCGTCGAGGACAAAATGGCCTACCTGATCAAGTGCCTCCATTTCCGGCGCGAGCCCAAG
TTCCTCGACGCCAATCCCGTCACCCAGATGGCCGAGAGGCTACGAGAAGGGCTGATCGAGTGCGGCGCAATGGAA
AAGGACCTCTATCTCTACACCGTCCTCCTGCTCAATCCAGGCCGTCGCACCCTCGTCTTCACCAACTCCATCTCG
GCCGTCCGCCGCCTGACGCCCCTGCTGCAGAACCTCAAGCTGGAGGTGCTGCCGCTGCACTCGCAGATGGCGCAG
AAGGCGCGGCTACGCTCGCTCGAGCGCTTCGCCGAGCTTCCCAGCTCGATCCTGGTAGCCACCGACGTGGCGGCC
CGCGGGCTCGACATCCACGAGGTCGACCAGGTCCTGCACTACCACGTGCCTCGCACGGCGGACACGTACGTCCAC
CGCTCGGGCCGGACGGCCCGCGGCGAGCACAGCGGCGTCAGCATCATCCTGTGCTCGCCTGACGAGGTGATGCCG
ACGCGGCGGCTGGCGGCCAAGGTCCACGCCGAGCGGCGGTCGGCGGGGGACAGCCGCCAGCAGCACATGATCCAG
GCGCTGCCGGTCGACCGCAAGATCGCCTCTCGGCTGCGGCCGCGCGTCGAGCTGTCGAAGCGCCTCGCCGACGCG
GTGCTGGCCAAGGAGAAGGCCGGCAGCGACGACGCGTGGCTGCGCGCGGCGGCCGAGGAGCTGGGCGTCGAGTAC
GACGCCGACGAGTTCGAGAGCGCGGCCGCGGGCGGCAGCTGGGGCGGCCGGGGCGGCGGCCGCAAGCGCAAGGAG
AAGGAGGCCAGGGCGCTGAGCAAGGCAGAGATGGGCGCGCTGAGGGCGCAGCTGCGCGAGGAGCTGGGCCGCCGC
GTCAACCTCGGCGTCAGCGAGCGATACATCACCGGCGGGAGGGTCGACGTCGGCGCGCTCTTGAGGGAGCGCAAC
GGGGCGCCCGGCGCCGTCTTCCTCGGCGGAGACGACCTGGGCCTCGGCCTCCTTTAG
Transcript >Hirsu2|5849
ATGACCTCTTCTTCAAAGAAGCGCAAGCTTCTCGCAGCCGTCGGACCGGCGCCGAAGCGCAGCAAGAGCCAGACC
GGGAAGACGGCGACTTCGAAATCCGCGGGCAAGAAGCCGGTCCCGCAGCGCATCGTCGACGCGTCCGCGCTCGCC
TGGAGACAGTTCGACGAGGAGTTTGGCGGATTGGAGGTAGTCAGCGGCGTCAGTGTCGTCAAGAACGGAGACCAG
GTGCAGTTCACGCAGAGGGAGTCGGACAAAGACGACGGCGGGGGCGCCAGTTCGCAAGAGCCAGATGAGGAGTCT
TTTGAAGGGTTTGGCGACGACGCTGTGGAGGGCCAAGATGTCGGTCCCGGCCAAGCTGGCTGCCCTCAAGCTTCT
GTGGGGAGCCCGGAGGGTCAAGAAAAGGCTGCAGACAAGGGCAAGGGTAAGCCGAAGAAGAAGGGCCCGCAGCAG
AAGGGCGGCCAGGCAACCGTCGCGGCGGCAGCAGCTGAAGGACTTCTTCCAAAGGCCGGCAAGCACGGCGGCAGT
AACTCCTTCGGCGCGCTCGCGGACATGTCAGAGGTCGGAGAGGGCAACGTCGACGTGGCGGACTGGGTGGCGCTG
AAGCTGTCGCCGCGCATCCTGTCGGCGATCGCGCGCCTCGGCTTTGCGAGGCCGACGGCGATCCAGAAGATGGCG
ATTCCGGAGATCATCGCGGGTGAGGACGTCATCGGCAAGGCGCAGACGGGGTCCGGCAAGACGCTGTCGTTTGGG
ATCCCAATCGTCGAGCGCTGGCTCGAGACGCGTGAGGACGGACAAGAGGAGTTGGACGACGACGGAGCAGCTGCC
GCCGCCGCGCGCGAGGCGGCTCCCCTGGCGCTGGTGCTGAGTCCGACGCGCGAGCTGGCCAAGCAGCTGGGCGAC
CACCTCAAGGCGCTGTGCGACGACCTCGCGGCCGCGCCCTACGTCTGCGTCGTCACCGGCGGCCTCAGCGTCCAG
AAGCAGCAGCGGCAGCTGGCCAAGGCCGACATCGTCATCGGGACGCCCGGCCGGCTGTGGGAGCTGATGGACGGG
GACGCCAAGCTGCAGGAGACGCTGACGCGCATCCGCTTCCTCGTCGTCGACGAGGCCGACCGCCTCTTCACCGCC
GGCCAGTTCCAGGAGGCCCAGGACATCATCGGCGCCCTGGACCGTCGCGACCCCGACGGGGACGCCGCGCCGCCC
ACGCCGCGCCAAACACTCATCTTCTCCGCTACCTTCGACAAGAACCTCCAGACGAAGCTCGCCGGCAGGGGCAGG
ACCGCAACCACCGCCGGCGTCGAGGACAAAATGGCCTACCTGATCAAGTGCCTCCATTTCCGGCGCGAGCCCAAG
TTCCTCGACGCCAATCCCGTCACCCAGATGGCCGAGAGGCTACGAGAAGGGCTGATCGAGTGCGGCGCAATGGAA
AAGGACCTCTATCTCTACACCGTCCTCCTGCTCAATCCAGGCCGTCGCACCCTCGTCTTCACCAACTCCATCTCG
GCCGTCCGCCGCCTGACGCCCCTGCTGCAGAACCTCAAGCTGGAGGTGCTGCCGCTGCACTCGCAGATGGCGCAG
AAGGCGCGGCTACGCTCGCTCGAGCGCTTCGCCGAGCTTCCCAGCTCGATCCTGGTAGCCACCGACGTGGCGGCC
CGCGGGCTCGACATCCACGAGGTCGACCAGGTCCTGCACTACCACGTGCCTCGCACGGCGGACACGTACGTCCAC
CGCTCGGGCCGGACGGCCCGCGGCGAGCACAGCGGCGTCAGCATCATCCTGTGCTCGCCTGACGAGGTGATGCCG
ACGCGGCGGCTGGCGGCCAAGGTCCACGCCGAGCGGCGGTCGGCGGGGGACAGCCGCCAGCAGCACATGATCCAG
GCGCTGCCGGTCGACCGCAAGATCGCCTCTCGGCTGCGGCCGCGCGTCGAGCTGTCGAAGCGCCTCGCCGACGCG
GTGCTGGCCAAGGAGAAGGCCGGCAGCGACGACGCGTGGCTGCGCGCGGCGGCCGAGGAGCTGGGCGTCGAGTAC
GACGCCGACGAGTTCGAGAGCGCGGCCGCGGGCGGCAGCTGGGGCGGCCGGGGCGGCGGCCGCAAGCGCAAGGAG
AAGGAGGCCAGGGCGCTGAGCAAGGCAGAGATGGGCGCGCTGAGGGCGCAGCTGCGCGAGGAGCTGGGCCGCCGC
GTCAACCTCGGCGTCAGCGAGCGATACATCACCGGCGGGAGGGTCGACGTCGGCGCGCTCTTGAGGGAGCGCAAC
GGGGCGCCCGGCGCCGTCTTCCTCGGCGGAGACGACCTGGGCCTCGGCCTCCTTTAG
Gene >Hirsu2|5849
ATGACCTCTTCTTCAAAGAAGCGCAAGCTTCTCGCAGCCGTCGGACCGGCGCCGAAGCGCAGCAAGAGCCAGACC
GGGAAGACGGCGACTTCGAAATCCGCGGGCAAGAAGCCGGTCCCGCAGCGCATCGTCGACGCGTCCGCGCTCGCC
TGGAGACAGTTCGACGAGGAGTTTGGCGGATTGGAGGTAGTCAGCGGCGTCAGTGTCGTCAAGAACGGAGACCAG
GTGCAGTTCACGCAGAGGGAGTCGGACAAAGACGACGGCGGGGGCGCCAGTTCGCAAGAGCCAGATGAGGAGTCT
TTTGAAGGGTTTGGCGACGACGCTGTGGAGGGCCAAGATGTCGGTCCCGGCCAAGCTGGCTGCCCTCAAGCTTCT
GTGGGGAGCCCGGAGGGTCAAGAAAAGGCTGCAGACAAGGGCAAGGGTAAGCCGAAGAAGAAGGGCCCGCAGCAG
AAGGGCGGCCAGGCAACCGTCGCGGCGGCAGCAGCTGAAGGACTTCTTCCAAAGGCCGGCAAGCACGGCGGCAGT
AACTCCTTCGGCGCGCTCGCGGACATGTCAGAGGTCGGAGAGGGCAACGTCGACGTGGCGGACTGGGTGGCGCTG
AAGCTGTCGCCGCGCATCCTGTCGGCGATCGCGCGCCTCGGCTTTGCGAGGCCGACGGCGATCCAGAAGATGGCG
ATTCCGGAGATCATCGCGGGTGAGGACGTCATCGGCAAGGCGCAGACGGGGTCCGGCAAGACGCTGTCGTTTGGG
ATCCCAATCGTCGAGCGCTGGCTCGAGACGCGTGAGGACGGACAAGAGGAGTTGGACGACGACGGAGCAGCTGCC
GCCGCCGCGCGCGAGGCGGCTCCCCTGGCGCTGGTGCTGAGTCCGACGCGCGAGCTGGCCAAGCAGCTGGGCGAC
CACCTCAAGGCGCTGTGCGACGACCTCGCGGCCGCGCCCTACGTCTGCGTCGTCACCGGCGGCCTCAGCGTCCAG
AAGCAGCAGCGGCAGCTGGCCAAGGCCGACATCGTCATCGGGACGCCCGGCCGGCTGTGGGAGCTGATGGACGGG
GACGCCAAGCTGCAGGAGACGCTGACGCGCATCCGCTTCCTCGTCGTCGACGAGGCCGACCGCCTCTTCACCGCC
GGCCAGTTCCAGGAGGCCCAGGACATCATCGGCGCCCTGGACCGTCGCGACCCCGACGGGGACGCCGCGCCGCCC
ACGCCGCGCCAAACACTCATCTTCTCCGCTACCTTCGACAAGAACCTCCAGACGAAGCTCGCCGGCAGGGGCAGG
ACCGCAACCACCGCCGGCGTCGAGGACAAAATGGCCTACCTGATCAAGTGCCTCCATTTCCGGCGCGAGCCCAAG
TTCCTCGACGCCAATCCCGTCACCCAGATGGCCGAGAGGCTACGAGAAGGGCTGATCGAGTGCGGCGCAATGGAA
AAGGTGAGTGGCAGCACTATGTCTATAGCCTGTCCATGACGATTCCTCCATCCTGTCCACACCCCCCGACAATTG
TGTCTGTCTGATCATCGGGGCCCCCTCCGCTGACGTTTTCCGCGCGCCCGCGGTGCCCAGGACCTCTATCTCTAC
ACCGTCCTCCTGCTCAATCCAGGCCGTCGCACCCTCGTCTTCACCAACTCCATCTCGGCCGTCCGCCGCCTGACG
CCCCTGCTGCAGAACCTCAAGCTGGAGGTGCTGCCGCTGCACTCGCAGATGGCGCAGAAGGCGCGGCTACGCTCG
CTCGAGCGCTTCGCCGAGCTTCCCAGCTCGATCCTGGTAGCCACCGACGTGGCGGCCCGCGGGCTCGACATCCAC
GAGGTCGACCAGGTCCTGCACTACCACGTGCCTCGCACGGCGGACACGTACGTCCACCGCTCGGGCCGGACGGCC
CGCGGCGAGCACAGCGGCGTCAGCATCATCCTGTGCTCGCCTGACGAGGTGATGCCGACGCGGCGGCTGGCGGCC
AAGGTCCACGCCGAGCGGCGGTCGGCGGGGGACAGCCGCCAGCAGCACATGATCCAGGCGCTGCCGGTCGACCGC
AAGATCGCCTCTCGGCTGCGGCCGCGCGTCGAGCTGTCGAAGCGCCTCGCCGACGCGGTGCTGGCCAAGGAGAAG
GCCGGCAGCGACGACGCGTGGCTGCGCGCGGCGGCCGAGGAGCTGGGCGTCGAGTACGACGCCGACGAGTTCGAG
AGCGCGGCCGCGGGCGGCAGCTGGGGCGGCCGGGGCGGCGGCCGCAAGCGCAAGGAGAAGGAGGCCAGGGCGCTG
AGCAAGGCAGAGATGGGCGCGCTGAGGGCGCAGCTGCGCGAGGAGCTGGGCCGCCGCGTCAACCTCGGCGTCAGC
GAGCGATACATCACCGGCGGGAGGGTCGACGTCGGCGCGCTCTTGAGGGAGCGCAACGGGGCGCCCGGCGCCGTC
TTCCTCGGCGGAGACGACCTGGGCCTCGGCCTCCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail