Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5828
Gene name
LocationContig_2942:1122..1539
Strand-
Gene length (bp)417
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.3E-18 47 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 1 138 2.0E-42
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 1 138 1.0E-34
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 1 133 1.0E-20
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 1 133 2.0E-20
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 1 133 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 1 138 2.0E-42
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 1 138 1.0E-34
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 1 133 1.0E-20
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 1 133 2.0E-20
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 1 133 5.0E-20
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 1 136 8.0E-19
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 1 136 8.0E-19
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 1 136 3.0E-18
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 1 136 4.0E-18
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 1 132 6.0E-18
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 1 136 3.0E-16
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 1 136 5.0E-16
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 1 126 1.0E-15
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 1 138 2.0E-15
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 1 138 2.0E-14
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 1 138 2.0E-14
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 1 138 2.0E-14
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 1 132 2.0E-14
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 1 130 5.0E-14
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 1 138 1.0E-13
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 2 138 3.0E-13
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 1 138 3.0E-13
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 1 138 4.0E-13
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 1 138 4.0E-13
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 1 138 6.0E-13
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 1 138 1.0E-12
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 1 138 1.0E-12
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 1 138 1.0E-12
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 1 138 4.0E-12
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 1 130 7.0E-12
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 1 138 9.0E-12
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 1 138 1.0E-11
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 1 138 1.0E-11
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 1 133 1.0E-11
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 1 130 2.0E-11
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 1 130 2.0E-11
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 1 131 2.0E-11
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 1 138 3.0E-11
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 6 133 5.0E-11
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 1 138 1.0E-10
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 1 138 1.0E-10
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 42 133 1.0E-10
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 1 138 1.0E-10
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 1 130 2.0E-10
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 52 133 3.0E-10
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 4 132 8.0E-10
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 1 138 8.0E-10
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 46 138 1.0E-09
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 1 137 2.0E-09
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 4 132 2.0E-09
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 4 131 2.0E-09
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 50 137 3.0E-09
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 50 133 3.0E-09
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 4 130 3.0E-09
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 2 130 3.0E-09
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 10 133 4.0E-09
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 51 132 4.0E-09
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 52 137 4.0E-09
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 1 137 5.0E-09
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 10 133 6.0E-09
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 10 133 6.0E-09
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 4 136 6.0E-09
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 1 138 8.0E-09
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 50 137 1.0E-08
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 53 133 1.0E-08
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 9 132 1.0E-08
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 52 137 2.0E-08
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 1 130 2.0E-08
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 53 136 2.0E-08
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 47 133 2.0E-08
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 1 136 2.0E-08
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 53 133 3.0E-08
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 50 133 3.0E-08
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 12 136 4.0E-08
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 50 133 4.0E-08
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 50 133 5.0E-08
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 4 131 5.0E-08
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 4 131 5.0E-08
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 55 133 6.0E-08
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 50 133 6.0E-08
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 53 137 6.0E-08
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 1 133 6.0E-08
sp|Q9C9R4|BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana GN=At1g78180 PE=2 SV=1 46 138 6.0E-08
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 47 133 7.0E-08
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 1 133 8.0E-08
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 47 133 8.0E-08
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 30 133 9.0E-08
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 50 137 9.0E-08
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 50 136 1.0E-07
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 53 137 1.0E-07
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 4 131 1.0E-07
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 4 138 1.0E-07
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 44 130 1.0E-07
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 4 131 1.0E-07
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 50 137 2.0E-07
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 12 131 2.0E-07
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 1 137 2.0E-07
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 55 132 2.0E-07
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 1 136 2.0E-07
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 52 137 2.0E-07
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 53 132 2.0E-07
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 55 133 3.0E-07
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 1 133 3.0E-07
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 1 136 3.0E-07
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 59 136 3.0E-07
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 44 133 4.0E-07
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 51 137 4.0E-07
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 51 137 4.0E-07
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 44 130 4.0E-07
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 46 138 4.0E-07
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 39 130 4.0E-07
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 50 132 4.0E-07
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 50 133 5.0E-07
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 1 136 5.0E-07
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 7 137 5.0E-07
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 1 133 5.0E-07
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 47 133 6.0E-07
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 50 137 6.0E-07
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 19 131 6.0E-07
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 1 129 6.0E-07
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 52 137 6.0E-07
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 50 137 7.0E-07
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 39 130 7.0E-07
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 50 137 8.0E-07
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 1 133 8.0E-07
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 50 137 1.0E-06
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 55 134 1.0E-06
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 50 133 1.0E-06
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 36 132 1.0E-06
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 55 130 1.0E-06
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 39 133 1.0E-06
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 1 136 1.0E-06
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 1 133 2.0E-06
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 47 135 2.0E-06
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 49 133 2.0E-06
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 7 133 2.0E-06
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 38 135 2.0E-06
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 55 130 2.0E-06
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 4 138 2.0E-06
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 32 132 2.0E-06
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 1 133 3.0E-06
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 1 133 3.0E-06
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 53 133 3.0E-06
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 47 135 3.0E-06
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 53 133 3.0E-06
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 5 137 3.0E-06
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 47 133 4.0E-06
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 4 133 4.0E-06
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 49 133 4.0E-06
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 55 136 4.0E-06
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 49 137 4.0E-06
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 52 137 4.0E-06
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 53 135 6.0E-06
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 53 130 6.0E-06
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 52 133 6.0E-06
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 53 135 7.0E-06
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 47 133 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5828
MLGMLPYAGMSFLTHDTVSDLMRHPSLAPHTTLPRSHKQSPDKPAPLRSWAELTAGGAAGLISQTASYPLEVIRR
RMQVGGAVGDGHRLRLGETARAILQERGLRGFFVGLTIGYIKVIPLAAVSFYTYERMKLALGI*
Coding >Hirsu2|5828
ATGCTGGGCATGCTGCCGTACGCCGGCATGTCCTTCCTGACCCACGACACCGTGAGCGACCTGATGCGCCACCCG
TCGCTCGCGCCGCACACGACGCTGCCGCGGTCGCACAAGCAGTCGCCCGACAAGCCGGCGCCGCTGCGTTCGTGG
GCCGAGCTGACGGCGGGCGGCGCCGCCGGCCTGATCTCGCAGACGGCCTCGTACCCGCTCGAGGTCATCCGGCGC
CGCATGCAGGTCGGCGGCGCCGTCGGCGATGGTCACCGGCTGCGGCTGGGCGAGACGGCGAGGGCCATCCTGCAG
GAGCGGGGCCTGCGCGGCTTCTTCGTCGGCCTCACCATCGGATACATCAAGGTGATTCCCCTCGCGGCCGTCAGC
TTCTACACGTACGAGCGCATGAAGCTTGCCCTGGGCATCTGA
Transcript >Hirsu2|5828
ATGCTGGGCATGCTGCCGTACGCCGGCATGTCCTTCCTGACCCACGACACCGTGAGCGACCTGATGCGCCACCCG
TCGCTCGCGCCGCACACGACGCTGCCGCGGTCGCACAAGCAGTCGCCCGACAAGCCGGCGCCGCTGCGTTCGTGG
GCCGAGCTGACGGCGGGCGGCGCCGCCGGCCTGATCTCGCAGACGGCCTCGTACCCGCTCGAGGTCATCCGGCGC
CGCATGCAGGTCGGCGGCGCCGTCGGCGATGGTCACCGGCTGCGGCTGGGCGAGACGGCGAGGGCCATCCTGCAG
GAGCGGGGCCTGCGCGGCTTCTTCGTCGGCCTCACCATCGGATACATCAAGGTGATTCCCCTCGCGGCCGTCAGC
TTCTACACGTACGAGCGCATGAAGCTTGCCCTGGGCATCTGA
Gene >Hirsu2|5828
ATGCTGGGCATGCTGCCGTACGCCGGCATGTCCTTCCTGACCCACGACACCGTGAGCGACCTGATGCGCCACCCG
TCGCTCGCGCCGCACACGACGCTGCCGCGGTCGCACAAGCAGTCGCCCGACAAGCCGGCGCCGCTGCGTTCGTGG
GCCGAGCTGACGGCGGGCGGCGCCGCCGGCCTGATCTCGCAGACGGCCTCGTACCCGCTCGAGGTCATCCGGCGC
CGCATGCAGGTCGGCGGCGCCGTCGGCGATGGTCACCGGCTGCGGCTGGGCGAGACGGCGAGGGCCATCCTGCAG
GAGCGGGGCCTGCGCGGCTTCTTCGTCGGCCTCACCATCGGATACATCAAGGTGATTCCCCTCGCGGCCGTCAGC
TTCTACACGTACGAGCGCATGAAGCTTGCCCTGGGCATCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail