Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5826
Gene name
LocationContig_2940:13..511
Strand+
Gene length (bp)498
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 5.8E-07 13 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X8|ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp5 PE=1 SV=1 1 131 2.0E-24
sp|P53946|ARP5_YEAST Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP5 PE=1 SV=1 10 132 1.0E-23
sp|Q17GZ9|ARP5_AEDAE Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1 7 133 4.0E-14
sp|Q54E71|ARP5_DICDI Actin-related protein 5 OS=Dictyostelium discoideum GN=arpE PE=3 SV=1 11 131 2.0E-13
sp|Q80US4|ARP5_MOUSE Actin-related protein 5 OS=Mus musculus GN=Actr5 PE=1 SV=3 7 133 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X8|ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp5 PE=1 SV=1 1 131 2.0E-24
sp|P53946|ARP5_YEAST Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP5 PE=1 SV=1 10 132 1.0E-23
sp|Q17GZ9|ARP5_AEDAE Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1 7 133 4.0E-14
sp|Q54E71|ARP5_DICDI Actin-related protein 5 OS=Dictyostelium discoideum GN=arpE PE=3 SV=1 11 131 2.0E-13
sp|Q80US4|ARP5_MOUSE Actin-related protein 5 OS=Mus musculus GN=Actr5 PE=1 SV=3 7 133 5.0E-13
sp|Q293V2|ARP5_DROPS Actin-related protein 5 OS=Drosophila pseudoobscura pseudoobscura GN=Arp5 PE=3 SV=2 11 133 2.0E-11
sp|Q9VEC3|ARP5_DROME Actin-related protein 5 OS=Drosophila melanogaster GN=Arp5 PE=1 SV=1 11 133 8.0E-11
sp|Q940Z2|ARP5_ARATH Actin-related protein 5 OS=Arabidopsis thaliana GN=ARP5 PE=1 SV=2 11 133 3.0E-09
sp|Q12509|ARP6_YEAST Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP6 PE=1 SV=1 12 130 8.0E-08
sp|P30165|ACT2_PEA Actin-2 OS=Pisum sativum PE=2 SV=1 12 124 2.0E-07
sp|P30164|ACT1_PEA Actin-1 OS=Pisum sativum PE=2 SV=1 12 124 5.0E-07
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 12 124 6.0E-07
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 12 124 1.0E-06
sp|P30172|ACT12_SOLTU Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 12 124 2.0E-06
sp|P30173|ACT13_SOLTU Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 12 124 2.0E-06
sp|P30167|ACT3_SOLTU Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 12 124 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5826
LNAASQAVINQIHLNLERIRVPEVVFRPSIAGVDQAGIVEIAGDVLTQRLAGLPSRDDFLRDIFRRAATRCSATS
TTASATACAPCSDARLDAWKGAAAWAGSPAWREARISKEEYQEKGPEYIKEHEMGNSYA*
Coding >Hirsu2|5826
CTGAACGCGGCGTCGCAGGCCGTGATCAACCAGATCCACCTCAACTTGGAGCGGATCCGGGTGCCCGAGGTCGTC
TTCCGGCCGTCGATCGCGGGCGTCGACCAGGCGGGCATCGTCGAGATCGCGGGCGACGTGCTGACGCAGCGCCTG
GCCGGCCTGCCCAGCCGCGACGACTTCCTGCGCGACATCTTCCGACGGGCGGCAACACGCTGTTCCGCCACTTCG
ACGACCGCGTCCGCGACGGCCTGCGCGCCCTGCTCCGACGCCCGGCTCGACGCGTGGAAGGGCGCGGCCGCCTGG
GCCGGCTCGCCCGCCTGGAGGGAGGCGCGCATCTCCAAGGAGGAGTATCAGGAGAAGGGGCCCGAGTACATCAAG
GAGCACGAGATGGGCAACTCATACGCCTGA
Transcript >Hirsu2|5826
CTGAACGCGGCGTCGCAGGCCGTGATCAACCAGATCCACCTCAACTTGGAGCGGATCCGGGTGCCCGAGGTCGTC
TTCCGGCCGTCGATCGCGGGCGTCGACCAGGCGGGCATCGTCGAGATCGCGGGCGACGTGCTGACGCAGCGCCTG
GCCGGCCTGCCCAGCCGCGACGACTTCCTGCGCGACATCTTCCGACGGGCGGCAACACGCTGTTCCGCCACTTCG
ACGACCGCGTCCGCGACGGCCTGCGCGCCCTGCTCCGACGCCCGGCTCGACGCGTGGAAGGGCGCGGCCGCCTGG
GCCGGCTCGCCCGCCTGGAGGGAGGCGCGCATCTCCAAGGAGGAGTATCAGGAGAAGGGGCCCGAGTACATCAAG
GAGCACGAGATGGGCAACTCATACGCCTGA
Gene >Hirsu2|5826
CTGAACGCGGCGTCGCAGGCCGTGATCAACCAGATCCACCTCAACTTGGAGCGGATCCGGGTGCCCGAGGTCGTC
TTCCGGCCGTCGATCGCGGGCGTCGACCAGGCGGGCATCGTCGAGATCGCGGGCGACGTGCTGACGCAGCGCCTG
GCCGGCCTGCCCAGCCGCGACGACTTCCTGCGCGACATCTTCCGACGGGCGGCAACACGCTGTTCCGCCACTTCG
ACGACCGCGTCCGCGACGGCCTGCGCGCCCTGCTCCGACGCCCGGCTCGACGCGTGGAAGGGCGCGGCCGCCTGG
GCCGGCTCGCCCGCCTGGAGGGAGGCGCGCATCTCCAAGGAGGAGTATCAGGAGAAGGGGCCCGAGTACATCAAG
GTGAGCAGCCCCGCCCCCCTTCCCCCCTCGTGCTCTTTTCCGTGGCCGATTCCACAGCTTGCTAACATGCGTTCT
TCCCCCTCTGCCCTCCAGGAGCACGAGATGGGCAACTCATACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail