Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5817
Gene name
LocationContig_294:3527..4418
Strand-
Gene length (bp)891
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 7.0E-32 42 233
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.7E-18 50 238
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 4.6E-11 44 216
PF08659 KR KR domain 2.3E-08 43 162
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.7E-05 44 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 40 267 2.0E-13
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 10 269 5.0E-13
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 38 235 3.0E-12
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 42 226 7.0E-12
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 4 269 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 40 267 2.0E-13
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 10 269 5.0E-13
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 38 235 3.0E-12
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 42 226 7.0E-12
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 4 269 7.0E-12
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 40 269 2.0E-11
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 40 233 4.0E-11
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 40 233 4.0E-11
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 40 227 5.0E-11
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 37 264 6.0E-11
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 40 253 7.0E-11
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 42 272 2.0E-10
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 40 235 5.0E-10
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 40 273 5.0E-10
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 40 273 7.0E-10
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 40 222 8.0E-10
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 40 222 1.0E-09
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 42 226 2.0E-09
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 40 232 2.0E-09
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 10 270 3.0E-09
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 42 284 4.0E-09
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 42 222 4.0E-09
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 41 250 1.0E-08
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 40 239 1.0E-08
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 38 243 1.0E-08
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 3 229 2.0E-08
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 42 234 3.0E-08
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 42 234 3.0E-08
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 42 269 3.0E-08
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 38 243 4.0E-08
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 42 226 4.0E-08
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 38 231 6.0E-08
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 38 231 6.0E-08
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 44 227 7.0E-08
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 38 226 8.0E-08
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 31 226 1.0E-07
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 38 269 1.0E-07
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 41 226 1.0E-07
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 40 230 1.0E-07
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 40 230 1.0E-07
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 41 227 1.0E-07
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 40 230 1.0E-07
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 12 227 2.0E-07
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 3 272 2.0E-07
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 40 227 2.0E-07
sp|Q53882|DNRE_STRS5 Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 42 226 2.0E-07
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 38 269 2.0E-07
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 41 221 2.0E-07
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 42 222 2.0E-07
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 41 263 3.0E-07
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 41 263 3.0E-07
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 42 226 3.0E-07
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 41 227 4.0E-07
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 38 269 4.0E-07
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 41 227 5.0E-07
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 40 235 6.0E-07
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 10 229 6.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 40 266 8.0E-07
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 25 244 1.0E-06
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 40 229 1.0E-06
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 40 226 2.0E-06
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 41 226 2.0E-06
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 37 263 3.0E-06
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 40 226 3.0E-06
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 40 226 3.0E-06
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 40 232 3.0E-06
sp|Q920N9|DCXR_CAVPO L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1 41 227 4.0E-06
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 41 227 4.0E-06
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 42 251 5.0E-06
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 40 232 5.0E-06
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 40 266 5.0E-06
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 42 251 5.0E-06
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 37 263 5.0E-06
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 37 263 5.0E-06
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 42 269 5.0E-06
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 42 251 6.0E-06
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 42 251 6.0E-06
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 42 251 6.0E-06
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 41 227 6.0E-06
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 42 226 7.0E-06
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 42 226 8.0E-06
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 37 233 9.0E-06
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 40 227 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5817
MWKMPPSNGQPWWEQFQRPTKTFHQTSYDRIANENGFDGKGKTVFITGGANPVGLSICKAFAEAGVARIAIVQRS
IEQLEKAKAELEAGHPSTQVSIYPASVTDHRRMVEILKELGTVDVLILAATAMHGRFKAAEISTEAMQEAFDTNV
MATFNLTKAYIQLAPPAAGRKTIINVSTAAAEATRALRIGYGTSKAAAARLMQHFAVEHDKDEVRIISYHPGVFY
TPTIAQYAAKDAIEWDDINLPAHFALWLAGPESGFLHGRHVWSNWDVDELIELKDKLAKDADFLTIGLVQQ*
Coding >Hirsu2|5817
ATGTGGAAGATGCCTCCTTCAAACGGCCAGCCTTGGTGGGAGCAGTTCCAGCGTCCGACCAAGACGTTCCATCAA
ACCAGCTACGACCGCATCGCCAACGAAAACGGTTTCGATGGCAAGGGAAAGACAGTCTTCATCACGGGCGGCGCA
AATCCCGTCGGGCTCAGCATCTGCAAGGCCTTTGCCGAAGCCGGCGTCGCACGCATCGCCATAGTCCAACGCTCC
ATCGAGCAGCTGGAGAAGGCCAAGGCGGAGCTCGAAGCCGGCCATCCATCCACGCAGGTCTCCATCTATCCGGCG
AGCGTCACCGACCACAGGCGCATGGTCGAGATTCTTAAGGAATTGGGCACGGTCGACGTCCTGATTCTCGCCGCC
ACCGCCATGCACGGCCGGTTCAAGGCGGCGGAGATCAGCACCGAGGCCATGCAAGAGGCCTTCGACACCAACGTC
ATGGCCACCTTCAACCTCACTAAAGCCTATATCCAGCTGGCCCCGCCGGCAGCCGGCCGCAAGACCATCATCAAC
GTCTCGACGGCGGCGGCCGAGGCAACCAGGGCGCTTCGCATCGGCTACGGCACGAGCAAGGCCGCGGCCGCGCGG
CTCATGCAACACTTCGCCGTCGAGCATGACAAGGACGAGGTGAGGATCATCTCGTACCATCCGGGCGTCTTCTAC
ACGCCCACCATCGCCCAGTATGCCGCCAAAGATGCCATCGAGTGGGACGACATCAACTTGCCGGCCCATTTCGCG
CTCTGGTTGGCCGGGCCCGAAAGCGGCTTCTTGCACGGACGCCACGTCTGGTCCAACTGGGACGTTGATGAGTTG
ATTGAGCTCAAGGACAAGTTGGCCAAAGACGCCGACTTCTTAACGATCGGACTAGTGCAGCAGTGA
Transcript >Hirsu2|5817
ATGTGGAAGATGCCTCCTTCAAACGGCCAGCCTTGGTGGGAGCAGTTCCAGCGTCCGACCAAGACGTTCCATCAA
ACCAGCTACGACCGCATCGCCAACGAAAACGGTTTCGATGGCAAGGGAAAGACAGTCTTCATCACGGGCGGCGCA
AATCCCGTCGGGCTCAGCATCTGCAAGGCCTTTGCCGAAGCCGGCGTCGCACGCATCGCCATAGTCCAACGCTCC
ATCGAGCAGCTGGAGAAGGCCAAGGCGGAGCTCGAAGCCGGCCATCCATCCACGCAGGTCTCCATCTATCCGGCG
AGCGTCACCGACCACAGGCGCATGGTCGAGATTCTTAAGGAATTGGGCACGGTCGACGTCCTGATTCTCGCCGCC
ACCGCCATGCACGGCCGGTTCAAGGCGGCGGAGATCAGCACCGAGGCCATGCAAGAGGCCTTCGACACCAACGTC
ATGGCCACCTTCAACCTCACTAAAGCCTATATCCAGCTGGCCCCGCCGGCAGCCGGCCGCAAGACCATCATCAAC
GTCTCGACGGCGGCGGCCGAGGCAACCAGGGCGCTTCGCATCGGCTACGGCACGAGCAAGGCCGCGGCCGCGCGG
CTCATGCAACACTTCGCCGTCGAGCATGACAAGGACGAGGTGAGGATCATCTCGTACCATCCGGGCGTCTTCTAC
ACGCCCACCATCGCCCAGTATGCCGCCAAAGATGCCATCGAGTGGGACGACATCAACTTGCCGGCCCATTTCGCG
CTCTGGTTGGCCGGGCCCGAAAGCGGCTTCTTGCACGGACGCCACGTCTGGTCCAACTGGGACGTTGATGAGTTG
ATTGAGCTCAAGGACAAGTTGGCCAAAGACGCCGACTTCTTAACGATCGGACTAGTGCAGCAGTGA
Gene >Hirsu2|5817
ATGTGGAAGATGCCTCCTTCAAACGGCCAGCCTTGGTGGGAGCAGTTCCAGCGTCCGACCAAGACGTTCCATCAA
ACCAGCTACGACCGCATCGCCAACGAAAACGGTTTCGATGGCAAGGGAAAGACAGTCTTCATCACGGGCGGCGCA
AATCCCGTCGGGCTCAGCATCTGCAAGGCCTTTGCCGAAGCCGGCGTCGCACGCATCGCCATAGTCCAACGCTCC
ATCGAGCAGCTGGAGAAGGCCAAGGCGGAGCTCGAAGCCGGCCATCCATCCACGCAGGTCTCCATCTATCCGGCG
AGCGTCACCGACCACAGGCGCATGGTCGAGATTCTTAAGGAATTGGGCACGGTCGACGTCCTGATTCTCGCCGCC
ACCGCCATGCACGGCCGGTTCAAGGCGGCGGAGATCAGCACCGAGGCCATGCAAGAGGCCTTCGACACCAACGTC
ATGGCCACCTTCAACCTCACTAAAGCCTATATCCAGCTGGCCCCGCCGGCAGCCGGCCGCAAGACCATCATCAAC
GTCTCGACGGCGGCGGCCGAGGCAACCAGGGCGCTTCGCATCGGCTACGGCACGAGCAAGGCCGCGGCCGCGCGG
CTCATGCAACACTTCGCCGTCGAGCATGACAAGGACGAGGTGAGGATCATCTCGTACCATCCGGGCGTCTTCTAC
ACGCCCACCATCGCCCAGTATGCCGCCAAAGATGCCATCGAGTGGGACGACATCAACTTGCCGGCCCATTTCGCG
CTCTGGTTGGCCGGGCCCGAAAGCGGCTTCTTGCACGGACGCCACGTCTGGTCCAACTGGGACGTTGATGAGTTG
ATTGAGCTCAAGGACAAGTTGGCCAAAGACGCCGACTTCTTAACGATCGGACTAGTGCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail