Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|581
Gene name
LocationContig_1114:102..2947
Strand-
Gene length (bp)2845
Transcript length (bp)2475
Coding sequence length (bp)2475
Protein length (aa) 825

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 2.4E-87 293 676

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 158 821 5.0E-180
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 158 821 6.0E-180
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 158 821 7.0E-180
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 158 821 7.0E-180
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 158 821 8.0E-180
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 158 821 5.0E-180
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 158 821 6.0E-180
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 158 821 7.0E-180
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 158 821 7.0E-180
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 158 821 8.0E-180
sp|P51793|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2 158 821 2.0E-172
sp|Q61418|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2 148 821 2.0E-172
sp|P51794|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1 158 821 1.0E-171
sp|Q9TTU3|CLCN5_RABIT H(+)/Cl(-) exchange transporter 5 OS=Oryctolagus cuniculus GN=CLCN5 PE=2 SV=1 148 821 4.0E-171
sp|Q99P66|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1 148 821 9.0E-170
sp|Q5RDJ7|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1 158 821 2.0E-169
sp|P51796|CLCN5_RAT H(+)/Cl(-) exchange transporter 5 OS=Rattus norvegicus GN=Clcn5 PE=2 SV=1 148 821 3.0E-165
sp|Q9GKE7|CLCN5_PIG H(+)/Cl(-) exchange transporter 5 OS=Sus scrofa GN=CLCN5 PE=2 SV=1 148 821 4.0E-165
sp|Q5RBK4|CLCN5_PONAB H(+)/Cl(-) exchange transporter 5 OS=Pongo abelii GN=CLCN5 PE=2 SV=1 148 821 6.0E-165
sp|P51795|CLCN5_HUMAN H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens GN=CLCN5 PE=1 SV=1 148 821 6.0E-165
sp|Q9WVD4|CLCN5_MOUSE H(+)/Cl(-) exchange transporter 5 OS=Mus musculus GN=Clcn5 PE=1 SV=1 148 821 1.0E-164
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 254 796 1.0E-128
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 111 817 1.0E-112
sp|P37020|GEF1_YEAST Anion/proton exchange transporter GEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEF1 PE=1 SV=2 190 811 6.0E-84
sp|O94287|YOO2_SCHPO Uncharacterized chloride channel protein C887.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.02 PE=3 SV=2 231 811 2.0E-65
sp|P35525|CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus GN=Clcn2 PE=1 SV=1 279 776 2.0E-56
sp|Q54C67|CLCF_DICDI Chloride channel protein F OS=Dictyostelium discoideum GN=clcF PE=3 SV=1 277 779 3.0E-56
sp|P51788|CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2 279 776 2.0E-55
sp|Q9R0A1|CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus GN=Clcn2 PE=1 SV=2 279 776 3.0E-55
sp|P51789|CLCN2_RABIT Chloride channel protein 2 OS=Oryctolagus cuniculus GN=CLCN2 PE=2 SV=1 259 764 7.0E-55
sp|Q9WU45|CLCN2_CAVPO Chloride channel protein 2 OS=Cavia porcellus GN=CLCN2 PE=2 SV=1 259 764 2.0E-54
sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1 280 765 3.0E-54
sp|P35524|CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus GN=Clcn1 PE=1 SV=1 280 769 3.0E-52
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 160 751 4.0E-52
sp|P35523|CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens GN=CLCN1 PE=1 SV=3 280 783 5.0E-52
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 201 811 5.0E-52
sp|Q64347|CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus GN=Clcn1 PE=1 SV=3 280 778 2.0E-51
sp|Q9MZT1|CLCN1_CANLF Chloride channel protein 1 OS=Canis lupus familiaris GN=CLCN1 PE=1 SV=1 280 778 6.0E-51
sp|Q9VGH7|CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster GN=ClC-a PE=2 SV=3 279 764 1.0E-50
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 268 817 4.0E-48
sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3 276 765 1.0E-46
sp|P21564|CICH_TORMA Chloride channel protein OS=Torpedo marmorata PE=1 SV=1 280 765 3.0E-46
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 201 751 1.0E-45
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 261 801 5.0E-45
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 201 817 3.0E-44
sp|Q9TT16|CLCN6_RABIT Chloride transport protein 6 OS=Oryctolagus cuniculus GN=CLCN6 PE=2 SV=1 288 751 2.0E-42
sp|Q9W701|CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis GN=clcnkb PE=1 SV=1 257 783 3.0E-41
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium discoideum GN=clcE PE=3 SV=1 279 768 4.0E-41
sp|O35454|CLCN6_MOUSE Chloride transport protein 6 OS=Mus musculus GN=Clcn6 PE=1 SV=1 288 751 6.0E-41
sp|P51797|CLCN6_HUMAN Chloride transport protein 6 OS=Homo sapiens GN=CLCN6 PE=1 SV=2 288 751 9.0E-41
sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 201 817 6.0E-40
sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 201 817 2.0E-39
sp|Q4PKH3|CLCN7_BOVIN H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1 201 817 9.0E-36
sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 201 817 1.0E-34
sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 277 750 4.0E-34
sp|P51804|CLCKB_RABIT Chloride channel protein ClC-Kb OS=Oryctolagus cuniculus GN=CLCNKB PE=2 SV=1 275 777 2.0E-27
sp|P51803|CLCKA_RABIT Chloride channel protein ClC-Ka OS=Oryctolagus cuniculus GN=CLCNKA PE=2 SV=1 275 777 2.0E-27
sp|Q06393|CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus GN=Clcnka PE=1 SV=3 275 787 2.0E-25
sp|P51800|CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens GN=CLCNKA PE=1 SV=1 275 820 1.0E-24
sp|Q9WUB7|CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus GN=Clcnka PE=1 SV=2 280 787 7.0E-24
sp|Q9WUB6|CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus GN=Clcnkb PE=1 SV=2 275 780 8.0E-23
sp|P51801|CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens GN=CLCNKB PE=1 SV=3 275 780 2.0E-22
sp|P51802|CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus GN=Clcnkb PE=1 SV=1 275 770 6.0E-22
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 558 788 1.0E-21
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 279 511 8.0E-21
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 285 448 9.0E-20
sp|B5Y1L4|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1 277 689 2.0E-17
sp|A8ALD3|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1 285 675 2.0E-16
sp|A6T4V9|CLCA_KLEP7 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clcA PE=3 SV=1 278 675 7.0E-16
sp|B5BL83|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1 285 675 5.0E-15
sp|Q5PD50|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1 285 675 5.0E-15
sp|B5RHE1|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1 285 675 9.0E-15
sp|B4TK31|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1 285 675 1.0E-14
sp|B5FJ02|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1 285 675 1.0E-14
sp|B5F8R6|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1 285 675 1.0E-14
sp|A9MPK6|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1 285 675 2.0E-14
sp|B4TXQ7|CLCA_SALSV H(+)/Cl(-) exchange transporter ClcA OS=Salmonella schwarzengrund (strain CVM19633) GN=clcA PE=3 SV=1 285 675 3.0E-14
sp|A9N0Q1|CLCA_SALPB H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clcA PE=3 SV=1 285 675 3.0E-14
sp|B4SUY5|CLCA_SALNS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella newport (strain SL254) GN=clcA PE=3 SV=1 285 675 3.0E-14
sp|B5R3G7|CLCA_SALEP H(+)/Cl(-) exchange transporter ClcA OS=Salmonella enteritidis PT4 (strain P125109) GN=clcA PE=3 SV=1 285 675 3.0E-14
sp|C0Q5R6|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1 285 675 4.0E-14
sp|Q57T52|CLCA_SALCH H(+)/Cl(-) exchange transporter ClcA OS=Salmonella choleraesuis (strain SC-B67) GN=clcA PE=3 SV=1 285 675 4.0E-14
sp|Q8ZRP8|CLCA_SALTY H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clcA PE=1 SV=1 285 675 6.0E-14
sp|Q8Z9B3|CLCA_SALTI H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhi GN=clcA PE=3 SV=1 285 675 8.0E-14
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 563 821 1.0E-12
sp|A7MGR4|CLCA_CROS8 H(+)/Cl(-) exchange transporter ClcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clcA PE=3 SV=1 299 676 2.0E-10
sp|Q8XTT4|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2 343 692 4.0E-10
sp|Q8RXR2|CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana GN=CLC-F PE=2 SV=2 327 764 2.0E-08
sp|Q87GZ9|CLCA_VIBPA H(+)/Cl(-) exchange transporter ClcA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clcA PE=3 SV=1 286 438 3.0E-07
sp|B2U300|CLCA_SHIB3 H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clcA PE=3 SV=1 287 675 4.0E-07
sp|Q325Y4|CLCA_SHIBS H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 4 (strain Sb227) GN=clcA PE=3 SV=1 287 675 7.0E-07
sp|Q8ZEB3|CLCB_YERPE Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pestis GN=clcB PE=3 SV=2 334 674 9.0E-07
sp|Q3Z5K2|CLCA_SHISS H(+)/Cl(-) exchange transporter ClcA OS=Shigella sonnei (strain Ss046) GN=clcA PE=1 SV=1 287 675 1.0E-06
sp|B6HZD1|CLCA_ECOSE H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SE11) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|B7N824|CLCA_ECOLU H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|P37019|CLCA_ECOLI H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12) GN=clcA PE=1 SV=2 287 675 1.0E-06
sp|B1IQI5|CLCA_ECOLC H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|B1XD25|CLCA_ECODH H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / DH10B) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|C4ZRP8|CLCA_ECOBW H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|B7M196|CLCA_ECO8A H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O8 (strain IAI1) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|B7LGL7|CLCA_ECO55 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain 55989 / EAEC) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|B7UIK2|CLCA_ECO27 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|A7ZHP7|CLCA_ECO24 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clcA PE=3 SV=1 287 675 1.0E-06
sp|A7ZWA3|CLCA_ECOHS H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O9:H4 (strain HS) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|Q1RG33|CLCA_ECOUT H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain UTI89 / UPEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|Q8FL15|CLCA_ECOL6 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|A1A7K1|CLCA_ECOK1 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O1:K1 / APEC GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|B7MBD8|CLCA_ECO45 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|Q9AGD5|CLCB_YERPS Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clcB PE=3 SV=3 334 674 2.0E-06
sp|A7FHW4|CLCB_YERP3 Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcB PE=3 SV=1 334 674 2.0E-06
sp|B7LWB6|CLCA_ESCF3 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clcA PE=3 SV=1 206 675 2.0E-06
sp|Q32JV3|CLCA_SHIDS H(+)/Cl(-) exchange transporter ClcA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|B1LGV8|CLCA_ECOSM H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|Q0TLH6|CLCA_ECOL5 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|B7MP17|CLCA_ECO81 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O81 (strain ED1a) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|B7NIB8|CLCA_ECO7I H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|B5Z0D5|CLCA_ECO5E H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|P58244|CLCA_ECO57 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 GN=clcA PE=3 SV=1 287 675 2.0E-06
sp|C3LVE3|CLCA_VIBCM H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clcA PE=3 SV=1 287 415 2.0E-06
sp|Q9KM62|CLCA_VIBCH H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clcA PE=3 SV=1 287 415 2.0E-06
sp|A5F0D5|CLCA_VIBC3 H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clcA PE=3 SV=1 287 415 2.0E-06
sp|Q8GX93|CLCE_ARATH Chloride channel protein CLC-e OS=Arabidopsis thaliana GN=CLC-E PE=2 SV=2 580 681 2.0E-06
sp|A5F0D5|CLCA_VIBC3 H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clcA PE=3 SV=1 547 689 5.0E-06
sp|C3LVE3|CLCA_VIBCM H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clcA PE=3 SV=1 547 689 7.0E-06
sp|Q9KM62|CLCA_VIBCH H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clcA PE=3 SV=1 547 689 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005247 voltage-gated chloride channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006821 chloride transport Yes
GO:0022832 voltage-gated channel activity No
GO:0006820 anion transport No
GO:0015108 chloride transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008308 voltage-gated anion channel activity No
GO:0022803 passive transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0005253 anion channel activity No
GO:0022839 ion gated channel activity No
GO:0005254 chloride channel activity No
GO:0005216 ion channel activity No
GO:0022836 gated channel activity No
GO:0051179 localization No
GO:0022838 substrate-specific channel activity No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015267 channel activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 200 222 22
2 278 300 22
3 327 349 22
4 354 371 17
5 384 406 22
6 456 478 22
7 491 513 22
8 552 574 22
9 581 603 22
10 623 640 17
11 647 669 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|581
MNRTMSRAIQSDYAFASASSSSHSPPANTPPPSDDRDELDFPDDADDQEDGDSVHVRRSGDDEILDDDPTRDDMS
VPLSFKRRPAPSLLSAPARFLSSLGGSRSPRRDFASSQPRRSPGLAGSSAAPQRTGLNSLNSTAKDALSHDWYTE
GPGRRVGYEDLTAIDWIFEYTKERQRQRVLSSSATGILGYAQRLLDASQIWVVLILTGLLVGVIAAGIDITTDWL
ADLKLGFCSSGPEGGHFYLNKSFCCYGYDQGSKCLGWKYWSDALGVHAAGGKWFIEYIFFILFSVTLAYCAAVLV
QEYAMYAKHSGIPEIKTVLGGFVIRRFLGTWTLVTKALGLVLAVGSGMWLGKEGPLVHVACCCASLFIKLFGNIR
DNEARKREVLSAAAAAGISVAFGSPIGGVLFSLEQLSYYFPDKTMWQSFVCAMTAAVVLQAFDPFRSGKLVLYQT
KYSVDWHGFEIVPYALLGIFGGVYGGLFIKANMAVARWKTARAWLPSPIAQVLAVALLTALINYPNSYMKVQSSE
LVSNLFADCARVLDDQVGLCKTGAASAGTIILLILAAVLGFLLATITFGLQIPAGIILPSMAIGALAGRAVGIIM
EIWVSNHADFFVFSSCAPDAPCITPGTYAIIGAAAALAGVTRMTVSIVVITFELTGALTYVLPIMVAVMISKWVG
DAFSRRGIYESWIHFNEYPFLDNSEEMVVPDVPVSQIMTRIEDLVVLTATGHSIASLNAILETHPYRGFPVISDP
RDAILLGYISRGELSYNLRTATQPPRSLAPETEAFFSHQPLADPRSTLDLRPWMDQTPLTLLSRTSLHLAVSAS*
Coding >Hirsu2|581
ATGAACCGAACCATGTCTAGGGCCATTCAGAGCGACTATGCATTTGCTTCCGCCTCATCGTCTTCCCACTCCCCT
CCGGCTAACACGCCGCCCCCTTCCGACGACCGCGACGAGCTCGACTTCCCGGACGACGCCGACGACCAAGAAGAT
GGCGATAGCGTCCATGTCCGCCGTTCGGGCGACGATGAAATCCTCGACGACGACCCTACGCGCGACGACATGAGC
GTTCCCCTATCCTTCAAGCGAAGGCCGGCTCCCTCGCTGCTCTCCGCGCCGGCCCGCTTCCTCTCCTCCCTTGGC
GGCTCGCGATCGCCTCGCCGCGACTTTGCGTCTTCCCAGCCGCGCCGTTCCCCCGGGCTCGCGGGATCCTCCGCC
GCGCCGCAAAGAACCGGCCTGAACAGCCTCAACTCAACCGCCAAGGACGCACTGTCGCACGACTGGTATACTGAG
GGCCCCGGCCGACGCGTCGGATACGAGGACCTGACGGCCATCGACTGGATCTTCGAATACACGAAGGAACGGCAG
CGGCAGCGAGTGCTGTCCTCCAGTGCAACTGGAATCCTTGGCTATGCACAGCGGCTTCTGGACGCCAGCCAGATC
TGGGTCGTCTTGATCCTGACCGGTCTTCTCGTCGGTGTCATAGCTGCGGGCATCGACATAACTACCGACTGGCTG
GCCGATCTGAAGCTGGGCTTTTGCTCAAGCGGTCCCGAGGGGGGGCACTTCTATCTGAACAAGAGCTTCTGCTGC
TACGGCTACGACCAAGGTTCCAAGTGCTTGGGGTGGAAGTACTGGAGCGATGCGCTCGGTGTCCACGCTGCCGGC
GGCAAATGGTTCATCGAATACATCTTTTTCATTCTCTTCTCGGTGACGCTGGCATATTGCGCTGCTGTGCTTGTT
CAGGAGTATGCCATGTATGCCAAGCACAGCGGCATCCCGGAGATCAAGACGGTTCTTGGAGGATTCGTCATCCGC
AGGTTTCTCGGCACATGGACCCTGGTCACCAAAGCTCTCGGCCTGGTGCTGGCTGTCGGCTCTGGCATGTGGCTT
GGAAAGGAGGGGCCACTGGTCCATGTTGCCTGCTGTTGCGCGAGTCTCTTCATTAAGCTCTTCGGCAACATTAGG
GACAATGAAGCTCGAAAGCGAGAAGTGCTCTCGGCTGCGGCCGCAGCGGGCATTTCGGTTGCCTTTGGCTCCCCA
ATCGGCGGCGTCCTGTTCAGCCTCGAGCAACTCTCGTATTACTTTCCAGACAAAACCATGTGGCAGAGCTTTGTC
TGCGCCATGACGGCGGCCGTCGTGCTCCAGGCTTTTGACCCCTTTCGCTCGGGCAAACTTGTCCTCTACCAGACC
AAGTACAGCGTAGACTGGCACGGTTTCGAGATTGTCCCTTATGCGCTTCTCGGCATCTTTGGGGGTGTGTACGGT
GGCCTGTTTATCAAGGCCAACATGGCTGTTGCGCGATGGAAGACGGCCAGGGCCTGGCTCCCCAGTCCCATTGCC
CAGGTCTTGGCCGTGGCCCTGCTGACTGCGCTCATCAACTACCCAAACTCGTATATGAAAGTGCAGTCTTCGGAG
CTCGTCTCCAACCTCTTCGCCGACTGCGCGCGCGTCCTCGACGACCAGGTCGGCCTGTGCAAGACGGGTGCGGCG
TCTGCCGGCACCATCATTCTCCTGATCCTGGCCGCCGTGCTGGGCTTCCTGCTCGCGACCATCACCTTTGGCCTG
CAGATCCCCGCGGGCATCATCCTCCCGTCCATGGCCATCGGCGCCCTGGCCGGGCGCGCCGTGGGCATCATCATG
GAGATCTGGGTCAGCAACCACGCCGACTTCTTCGTGTTCTCGTCGTGCGCGCCCGACGCGCCGTGCATCACGCCC
GGGACGTACGCCATCATCGGCGCGGCCGCCGCACTCGCGGGCGTCACGCGGATGACGGTGTCCATCGTCGTCATC
ACGTTCGAGCTCACCGGGGCGCTCACGTACGTCCTCCCTATCATGGTGGCCGTCATGATCTCCAAGTGGGTCGGC
GACGCCTTTTCGCGACGCGGCATCTACGAGTCCTGGATCCATTTCAACGAGTACCCCTTCCTCGACAACAGCGAG
GAGATGGTGGTGCCGGACGTGCCCGTCTCGCAGATCATGACGCGCATCGAGGACCTGGTCGTCCTGACCGCCACG
GGCCACAGCATCGCCTCGCTCAACGCGATCCTCGAGACGCACCCGTACCGCGGCTTCCCCGTCATCTCGGACCCG
CGCGATGCCATCCTACTGGGCTACATCTCGCGCGGCGAGCTGAGCTACAACCTCCGGACGGCGACGCAGCCGCCG
CGGTCGCTGGCGCCGGAGACGGAGGCCTTCTTCTCGCACCAGCCGCTGGCGGACCCGCGCTCGACGCTCGACCTG
CGCCCCTGGATGGACCAGACGCCGCTGACGCTGCTGTCGCGCACGAGCCTGCACCTCGCCGTCTCGGCCTCCTGA
Transcript >Hirsu2|581
ATGAACCGAACCATGTCTAGGGCCATTCAGAGCGACTATGCATTTGCTTCCGCCTCATCGTCTTCCCACTCCCCT
CCGGCTAACACGCCGCCCCCTTCCGACGACCGCGACGAGCTCGACTTCCCGGACGACGCCGACGACCAAGAAGAT
GGCGATAGCGTCCATGTCCGCCGTTCGGGCGACGATGAAATCCTCGACGACGACCCTACGCGCGACGACATGAGC
GTTCCCCTATCCTTCAAGCGAAGGCCGGCTCCCTCGCTGCTCTCCGCGCCGGCCCGCTTCCTCTCCTCCCTTGGC
GGCTCGCGATCGCCTCGCCGCGACTTTGCGTCTTCCCAGCCGCGCCGTTCCCCCGGGCTCGCGGGATCCTCCGCC
GCGCCGCAAAGAACCGGCCTGAACAGCCTCAACTCAACCGCCAAGGACGCACTGTCGCACGACTGGTATACTGAG
GGCCCCGGCCGACGCGTCGGATACGAGGACCTGACGGCCATCGACTGGATCTTCGAATACACGAAGGAACGGCAG
CGGCAGCGAGTGCTGTCCTCCAGTGCAACTGGAATCCTTGGCTATGCACAGCGGCTTCTGGACGCCAGCCAGATC
TGGGTCGTCTTGATCCTGACCGGTCTTCTCGTCGGTGTCATAGCTGCGGGCATCGACATAACTACCGACTGGCTG
GCCGATCTGAAGCTGGGCTTTTGCTCAAGCGGTCCCGAGGGGGGGCACTTCTATCTGAACAAGAGCTTCTGCTGC
TACGGCTACGACCAAGGTTCCAAGTGCTTGGGGTGGAAGTACTGGAGCGATGCGCTCGGTGTCCACGCTGCCGGC
GGCAAATGGTTCATCGAATACATCTTTTTCATTCTCTTCTCGGTGACGCTGGCATATTGCGCTGCTGTGCTTGTT
CAGGAGTATGCCATGTATGCCAAGCACAGCGGCATCCCGGAGATCAAGACGGTTCTTGGAGGATTCGTCATCCGC
AGGTTTCTCGGCACATGGACCCTGGTCACCAAAGCTCTCGGCCTGGTGCTGGCTGTCGGCTCTGGCATGTGGCTT
GGAAAGGAGGGGCCACTGGTCCATGTTGCCTGCTGTTGCGCGAGTCTCTTCATTAAGCTCTTCGGCAACATTAGG
GACAATGAAGCTCGAAAGCGAGAAGTGCTCTCGGCTGCGGCCGCAGCGGGCATTTCGGTTGCCTTTGGCTCCCCA
ATCGGCGGCGTCCTGTTCAGCCTCGAGCAACTCTCGTATTACTTTCCAGACAAAACCATGTGGCAGAGCTTTGTC
TGCGCCATGACGGCGGCCGTCGTGCTCCAGGCTTTTGACCCCTTTCGCTCGGGCAAACTTGTCCTCTACCAGACC
AAGTACAGCGTAGACTGGCACGGTTTCGAGATTGTCCCTTATGCGCTTCTCGGCATCTTTGGGGGTGTGTACGGT
GGCCTGTTTATCAAGGCCAACATGGCTGTTGCGCGATGGAAGACGGCCAGGGCCTGGCTCCCCAGTCCCATTGCC
CAGGTCTTGGCCGTGGCCCTGCTGACTGCGCTCATCAACTACCCAAACTCGTATATGAAAGTGCAGTCTTCGGAG
CTCGTCTCCAACCTCTTCGCCGACTGCGCGCGCGTCCTCGACGACCAGGTCGGCCTGTGCAAGACGGGTGCGGCG
TCTGCCGGCACCATCATTCTCCTGATCCTGGCCGCCGTGCTGGGCTTCCTGCTCGCGACCATCACCTTTGGCCTG
CAGATCCCCGCGGGCATCATCCTCCCGTCCATGGCCATCGGCGCCCTGGCCGGGCGCGCCGTGGGCATCATCATG
GAGATCTGGGTCAGCAACCACGCCGACTTCTTCGTGTTCTCGTCGTGCGCGCCCGACGCGCCGTGCATCACGCCC
GGGACGTACGCCATCATCGGCGCGGCCGCCGCACTCGCGGGCGTCACGCGGATGACGGTGTCCATCGTCGTCATC
ACGTTCGAGCTCACCGGGGCGCTCACGTACGTCCTCCCTATCATGGTGGCCGTCATGATCTCCAAGTGGGTCGGC
GACGCCTTTTCGCGACGCGGCATCTACGAGTCCTGGATCCATTTCAACGAGTACCCCTTCCTCGACAACAGCGAG
GAGATGGTGGTGCCGGACGTGCCCGTCTCGCAGATCATGACGCGCATCGAGGACCTGGTCGTCCTGACCGCCACG
GGCCACAGCATCGCCTCGCTCAACGCGATCCTCGAGACGCACCCGTACCGCGGCTTCCCCGTCATCTCGGACCCG
CGCGATGCCATCCTACTGGGCTACATCTCGCGCGGCGAGCTGAGCTACAACCTCCGGACGGCGACGCAGCCGCCG
CGGTCGCTGGCGCCGGAGACGGAGGCCTTCTTCTCGCACCAGCCGCTGGCGGACCCGCGCTCGACGCTCGACCTG
CGCCCCTGGATGGACCAGACGCCGCTGACGCTGCTGTCGCGCACGAGCCTGCACCTCGCCGTCTCGGCCTCCTGA
Gene >Hirsu2|581
ATGAACCGAACCATGTCTAGGGCCATTCAGAGCGACTATGCATTTGCTTCCGCCTCATCGTCTTCCCACTCCCCT
CCGGCTAACACGCCGCCCCCTTCCGACGACCGCGACGAGCTCGACTTCCCGGACGACGCCGACGACCAAGAAGAT
GGCGATAGCGTCCATGTCCGCCGTTCGGGCGACGATGAAATCCTCGACGACGACCCTACGCGCGACGACATGAGC
GTTCCCCTATCCTTCAAGCGAAGGCCGGCTCCCTCGCTGCTCTCCGCGCCGGCCCGCTTCCTCTCCTCCCTTGGC
GGCTCGCGATCGCCTCGCCGCGACTTTGCGTCTTCCCAGCCGCGCCGTTCCCCCGGGCTCGCGGGATCCTCCGCC
GCGCCGCAAAGAACCGGCCTGAACAGCCTCAACTCAACCGCCAAGGACGCACTGTCGCACGACTGGTATACTGAG
GGCCCCGGCCGACGCGTCGGATACGAGGACCTGACGGCCATCGACTGGATCTTCGAATACACGAAGGAACGGCAG
CGGCAGCGAGTGCTGTCCTCCAGTGCAACTGGAATCCTTGGCTATGCACAGCGGCTTCTGGACGCCAGCCAGATC
TGGGTCGTCTTGATCCTGACCGGTCTTCTCGTCGGTGTCATAGCTGCGGGCATCGACATAACTACCGACTGGCTG
GCCGATCTGAAGCTGGGCTTTTGCTCAAGCGGTCCCGAGGGGGGGCACTTCTATCTGAACAAGAGCTTCTGCTGC
TACGGCTACGACCAAGGTTCCAAGTGCTTGGGGTGGAAGTACTGGAGCGATGCGCTCGGTGTCCACGCTGCCGGC
GGCAAATGGTTCATCGAATACATCTTTTTCATTCTCTTCTCGGTACGCAGTCGCTTCGCGAACCCGTGGGAACCC
GTCGTCTTGTGCTGACAAGTGCGGTAAGGTGACGCTGGCATATTGCGCTGCTGTGCTTGTTCAGGAGTATGCCAT
GTATGCCAAGCACAGCGGCATCCCGGAGATCAAGACGGTTCTTGGAGGATTCGTCATCCGCAGGTTTCTCGGCAC
ATGGACCCTGGTCACCAAAGCTCTCGGCCTGGTGAGACTTCTCTCACCCCTCCCATACGAGCTCCATGAAGCCGT
GACTGAACATGGCGAGCAGGTGCTGGCTGTCGGCTCTGGCATGTGGCTTGGAAAGGAGGGGCCACTGGTCCATGT
TGCCTGCTGTTGCGCGAGTCTCTTCATTAAGCTCTTCGGCAACATTAGGGACAATGAAGGTGGGAAAGCTGTAGA
CCCGGCGCTCCGGGGGCTGGCGGCTGATTCACGGCAGCTCGAAAGCGAGAAGTGCTCTCGGCTGCGGCCGCAGCG
GGCATTTCGGTTGCCTTTGGCTCCCCAATCGGCGGCGTCCTGTTCAGCCTCGAGGTATCGATGTCGTCTTCTTGT
CGTCTGCCGGTCGACTTGCGTATTCTTGGCTGCTGACTCTGCCCCAGCAACTCTCGTATTACTTTCCAGACAAAA
CCATGTGGCAGAGCTTTGTCTGCGCCATGACGGCGGCCGTCGTGCTCCAGGCTTTTGACCCCTTTCGCTCGGGCA
AACTTGTCCTCTACCAGACCAAGTACAGCGTAGACTGGCACGGTTTCGAGATTGTCCCTTATGCGCTTCTCGGCA
TCTTTGGGGTCCGTTCCCTCCAAGTGTGCCCTTGGTTATTTGTCAATGGTGGACGAATACTGATGCGCATCGCAG
GGTGTGTACGGTGGCCTGTTTATCAAGGCCAACATGGCTGTTGCGCGATGGAAGACGGCCAGGGCCTGGCTCCCC
AGTCCCATTGCCCAGGTCTTGGCCGTGGCCCTGCTGACTGCGCTCATCAACTACCCAAACTCGTATATGAAAGTG
CAGTCTTCGGAGCTCGTCTCCAACCTCTTCGCCGACTGCGCGCGCGTCCTCGACGACCAGGTCGGCCTGTGCAAG
ACGGGTGCGGCGTCTGCCGGCACCATCATTCTCCTGATCCTGGCCGCCGTGCTGGGCTTCCTGCTCGCGACCATC
ACCTTTGGCCTGCAGATCCCCGCGGGCATCATCCTCCCGTCCATGGCCATCGGCGCCCTGGCCGGGCGCGCCGTG
GGCATCATCATGGAGATCTGGGTCAGCAACCACGCCGACTTCTTCGTGTTCTCGTCGTGCGCGCCCGACGCGCCG
TGCATCACGCCCGGGACGTACGCCATCATCGGCGCGGCCGCCGCACTCGCGGGCGTCACGCGGATGACGGTGTCC
ATCGTCGTCATCACGTTCGAGCTCACCGGGGCGCTCACGTACGTCCTCCCTATCATGGTGGCCGTCATGATCTCC
AAGTGGGTCGGCGACGCCTTTTCGCGACGCGGCATCTACGAGTCCTGGATCCATTTCAACGAGTACCCCTTCCTC
GACAACAGCGAGGAGATGGTGGTGCCGGACGTGCCCGTCTCGCAGATCATGACGCGCATCGAGGACCTGGTCGTC
CTGACCGCCACGGGCCACAGCATCGCCTCGCTCAACGCGATCCTCGAGACGCACCCGTACCGCGGCTTCCCCGTC
ATCTCGGACCCGCGCGATGCCATCCTACTGGGCTACATCTCGCGCGGCGAGCTGAGCTACAACCTCCGGACGGCG
ACGCAGCCGCCGCGGTCGCTGGCGCCGGAGACGGAGGCCTTCTTCTCGCACCAGCCGCTGGCGGACCCGCGCTCG
ACGCTCGACCTGCGCCCCTGGATGGACCAGACGCCGCTGACGCTGCTGTCGCGCACGAGCCTGCACCTCGCCGTC
TCGTACTTCCAGAAGCTCGGCCTGCGCTACGTCCTCTTCAGCGACCGCGGCGCCCTTCAGGGCCTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail