Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|58
Gene name
LocationContig_1005:7100..8778
Strand+
Gene length (bp)1678
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 4.7E-66 130 407
PF13649 Methyltransf_25 Methyltransferase domain 1.7E-16 192 288
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-13 193 291
PF13489 Methyltransf_23 Methyltransferase domain 2.7E-12 181 298
PF08242 Methyltransf_12 Methyltransferase domain 4.7E-08 193 288
PF13847 Methyltransf_31 Methyltransferase domain 3.5E-07 191 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 48 421 5.0E-53
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 49 406 2.0E-42
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 49 406 2.0E-42
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 135 420 9.0E-36
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 101 365 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 48 421 5.0E-53
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 49 406 2.0E-42
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 49 406 2.0E-42
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 135 420 9.0E-36
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 101 365 2.0E-33
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 129 365 9.0E-32
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 129 398 1.0E-31
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 129 366 7.0E-29
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 129 404 3.0E-28
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 129 418 1.0E-27
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 129 418 1.0E-27
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 129 418 1.0E-27
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 139 362 6.0E-26
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 139 362 6.0E-26
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 139 362 6.0E-26
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 139 362 6.0E-26
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 139 404 4.0E-24
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 133 404 3.0E-23
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 133 404 3.0E-23
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 133 404 3.0E-23
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 126 404 3.0E-20
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 126 404 3.0E-20
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 126 404 3.0E-20
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 123 404 4.0E-20
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 123 404 4.0E-20
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 123 404 4.0E-20
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 138 358 5.0E-20
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 138 358 5.0E-20
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 138 358 5.0E-20
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 133 404 9.0E-20
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 133 404 9.0E-20
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 138 358 1.0E-18
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 168 373 6.0E-13
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 168 374 8.0E-13
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 139 365 8.0E-12
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 139 374 3.0E-11
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 139 374 5.0E-11
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 138 306 4.0E-10
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 139 321 4.0E-10
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 168 321 6.0E-10
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 169 306 7.0E-10
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 138 306 1.0E-09
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 138 306 3.0E-09
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 139 287 3.0E-09
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 166 306 1.0E-08
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 138 306 7.0E-08
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 124 287 9.0E-08
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 164 308 9.0E-08
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 167 313 1.0E-07
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 136 306 1.0E-07
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 172 315 2.0E-07
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 166 287 2.0E-07
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 166 287 2.0E-07
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 167 287 2.0E-07
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 166 306 3.0E-07
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 132 310 4.0E-07
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 138 306 8.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 138 306 9.0E-07
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 166 301 1.0E-06
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 172 315 2.0E-06
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 170 306 2.0E-06
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 138 287 2.0E-06
sp|Q57060|Y095_HAEIN Uncharacterized protein HI_0095 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0095 PE=4 SV=1 192 293 3.0E-06
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 166 301 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|58
MTESWLQSAARSLICRALGRIRHGQLRLKVKYSEDGGDEVVLGPPPTADGPGAVVVAINHPHAWVRMLQSMDLGF
AEAYMQQEVDCDDLLGLFCLHIGNTDALGHSTDLTAWQLLPLAARYLDAGNVVSRSRANIAFHYDESSDFFGSFL
SADMNYSSALWSGSAGETLEAAQLRKERLVLERARIAASHHVLDIGCGWGHWAVEAARQTGCRVTGLTLSRAQKA
RAEERIAAAGLQGRVDVVLCDYREAPRVEGGYDRVVSVEMLEHVGCNFIHRFFHEISALLKPDSGLMVIQGITTH
RKSSPNLDTFIGRYIFPGGYLHSSHDLLEAIHAGSQGALQVETVENIGPHYVRTLRCWRQNFLRNWPATRTVFID
KNPDATEADVEAFRRRWEYYFTYCEAGFRTRLLGDHVISAVRPFSPTNCRQLVEA*
Coding >Hirsu2|58
ATGACGGAAAGCTGGCTCCAGTCCGCGGCCCGGTCGCTCATCTGCCGAGCGCTGGGCCGGATCCGCCACGGGCAG
CTGCGGCTGAAGGTGAAGTATTCCGAGGATGGAGGAGACGAGGTCGTGCTGGGGCCGCCGCCGACGGCCGACGGT
CCGGGGGCCGTCGTGGTGGCCATCAACCACCCGCACGCCTGGGTGAGGATGTTGCAGTCGATGGACCTGGGATTC
GCAGAGGCCTACATGCAGCAAGAGGTTGACTGCGACGACCTCTTGGGCCTGTTTTGCCTGCACATCGGCAACACG
GACGCGCTCGGGCACTCGACGGACCTGACGGCGTGGCAGCTGCTGCCGCTGGCGGCGCGGTACCTGGACGCGGGC
AACGTCGTCAGCCGGTCGCGGGCCAACATCGCCTTCCACTACGACGAGTCGAGCGACTTCTTCGGCAGCTTCCTG
TCGGCCGACATGAACTACTCGTCGGCGCTGTGGTCGGGGTCGGCGGGCGAGACGCTCGAGGCGGCGCAGCTGCGC
AAGGAGCGGCTGGTGCTGGAGCGGGCGCGGATCGCGGCCTCGCACCACGTGCTCGACATCGGCTGCGGCTGGGGC
CACTGGGCCGTCGAGGCGGCGCGGCAGACGGGCTGCCGCGTGACGGGCCTGACGCTGTCGCGGGCGCAGAAGGCG
CGCGCCGAGGAGCGCATCGCCGCCGCCGGCCTGCAGGGCCGCGTCGACGTCGTGCTGTGCGACTACCGCGAGGCG
CCCCGGGTCGAGGGCGGCTACGACCGCGTCGTCTCCGTCGAGATGCTCGAGCACGTCGGCTGCAACTTCATCCAC
CGCTTCTTCCACGAGATCTCGGCCCTGCTGAAGCCGGACAGCGGCCTGATGGTGATTCAGGGCATCACCACCCAC
CGCAAGTCGTCGCCCAACCTCGACACCTTCATCGGCCGCTACATCTTCCCCGGCGGCTACCTGCACTCGAGCCAC
GACCTGCTCGAGGCCATCCACGCCGGCTCGCAAGGCGCGCTGCAGGTCGAGACGGTCGAGAACATCGGGCCGCAC
TACGTCCGCACCCTGCGCTGCTGGCGCCAGAACTTCCTGCGCAACTGGCCGGCCACCAGGACCGTCTTCATCGAC
AAGAACCCGGACGCGACCGAGGCCGACGTCGAGGCCTTTCGCCGCCGATGGGAGTATTACTTCACCTACTGCGAG
GCTGGCTTCAGGACGAGGCTGCTCGGGGACCACGTCATTTCGGCCGTCCGGCCCTTTTCGCCCACAAACTGTAGA
CAGCTCGTCGAGGCCTGA
Transcript >Hirsu2|58
ATGACGGAAAGCTGGCTCCAGTCCGCGGCCCGGTCGCTCATCTGCCGAGCGCTGGGCCGGATCCGCCACGGGCAG
CTGCGGCTGAAGGTGAAGTATTCCGAGGATGGAGGAGACGAGGTCGTGCTGGGGCCGCCGCCGACGGCCGACGGT
CCGGGGGCCGTCGTGGTGGCCATCAACCACCCGCACGCCTGGGTGAGGATGTTGCAGTCGATGGACCTGGGATTC
GCAGAGGCCTACATGCAGCAAGAGGTTGACTGCGACGACCTCTTGGGCCTGTTTTGCCTGCACATCGGCAACACG
GACGCGCTCGGGCACTCGACGGACCTGACGGCGTGGCAGCTGCTGCCGCTGGCGGCGCGGTACCTGGACGCGGGC
AACGTCGTCAGCCGGTCGCGGGCCAACATCGCCTTCCACTACGACGAGTCGAGCGACTTCTTCGGCAGCTTCCTG
TCGGCCGACATGAACTACTCGTCGGCGCTGTGGTCGGGGTCGGCGGGCGAGACGCTCGAGGCGGCGCAGCTGCGC
AAGGAGCGGCTGGTGCTGGAGCGGGCGCGGATCGCGGCCTCGCACCACGTGCTCGACATCGGCTGCGGCTGGGGC
CACTGGGCCGTCGAGGCGGCGCGGCAGACGGGCTGCCGCGTGACGGGCCTGACGCTGTCGCGGGCGCAGAAGGCG
CGCGCCGAGGAGCGCATCGCCGCCGCCGGCCTGCAGGGCCGCGTCGACGTCGTGCTGTGCGACTACCGCGAGGCG
CCCCGGGTCGAGGGCGGCTACGACCGCGTCGTCTCCGTCGAGATGCTCGAGCACGTCGGCTGCAACTTCATCCAC
CGCTTCTTCCACGAGATCTCGGCCCTGCTGAAGCCGGACAGCGGCCTGATGGTGATTCAGGGCATCACCACCCAC
CGCAAGTCGTCGCCCAACCTCGACACCTTCATCGGCCGCTACATCTTCCCCGGCGGCTACCTGCACTCGAGCCAC
GACCTGCTCGAGGCCATCCACGCCGGCTCGCAAGGCGCGCTGCAGGTCGAGACGGTCGAGAACATCGGGCCGCAC
TACGTCCGCACCCTGCGCTGCTGGCGCCAGAACTTCCTGCGCAACTGGCCGGCCACCAGGACCGTCTTCATCGAC
AAGAACCCGGACGCGACCGAGGCCGACGTCGAGGCCTTTCGCCGCCGATGGGAGTATTACTTCACCTACTGCGAG
GCTGGCTTCAGGACGAGGCTGCTCGGGGACCACGTCATTTCGGCCGTCCGGCCCTTTTCGCCCACAAACTGTAGA
CAGCTCGTCGAGGCCTGA
Gene >Hirsu2|58
ATGACGGAAAGCTGGCTCCAGTCCGCGGCCCGGTCGCTCATCTGCCGAGCGCTGGGCCGGATCCGCCACGGGCAG
CTGCGGCTGAAGGTGAAGTATTCCGAGGATGGAGGAGACGAGGTCGTGCTGGGGCCGCCGCCGACGGCCGACGGT
CCGGGGGCCGTCGTGGTGGCCATCAACCACCCGCACGCCTGGGTGAGGATGTTGCAGTCGATGGACCTGGTACGC
GCTGTCCGATTCGCAGAGCACGCAGGGACAGAGAGAGAGAGAGAGAAGAGAGAGAGAGAGAGAGAGAGAGAGACG
CTGACGGAGGGGGCGCCGACAGGGATTCGCAGAGGCCTACATGCAGCAAGAGGTTGACTGCGACGACCTCTTGGG
CCTGTTTTGCGTAAGGCGCGGACCCGTGCATTCATGATTTCGATGCTCCCCCGTCGGATCGAAGAGCGGAGTGGT
CAAGAGGAATCCGGCTGACGGAACGTTGATCGTCAGCTGCACATCGGCAACACGGACGCGCTCGGGCACTCGACG
GACCTGACGGCGTGGCAGCTGCTGCCGCTGGCGGCGCGGTACCTGGACGCGGGCAACGTCGTCAGCCGGTCGCGG
GCCAACATCGCCTTCCACTACGACGAGTCGAGCGACTTCTTCGGCAGCTTCCTGTCGGCCGACATGAACTACTCG
TCGGCGCTGTGGTCGGGGTCGGCGGGCGAGACGCTCGAGGCGGCGCAGCTGCGCAAGGAGCGGCTGGTGCTGGAG
CGGGCGCGGATCGCGGCCTCGCACCACGTGCTCGACATCGGCTGCGGCTGGGGCCACTGGGCCGTCGAGGCGGCG
CGGCAGACGGGCTGCCGCGTGACGGGCCTGACGCTGTCGCGGGCGCAGAAGGCGCGCGCCGAGGAGCGCATCGCC
GCCGCCGGCCTGCAGGGCCGCGTCGACGTCGTGCTGTGCGACTACCGCGAGGCGCCCCGGGTCGAGGGCGGCTAC
GACCGCGTCGTCTCCGTCGAGATGCTCGAGCACGTCGGCTGCAACTTCATCCACCGCTTCTTCCACGAGATCTCG
GCCCTGCTGAAGCCGGACAGCGGCCTGATGGTGATTCAGGGCATCACCACCCACCGGTGCGTGCGAGTCCTGGAC
GAGTCAGAGAGAGAGAGCGAGAGGGAAGCAGATGGGGAGCTCGGTGGCTGACGTGCGTGCGGGCCGGCTCAGCAA
GTCGTCGCCCAACCTCGACACCTTCATCGGCCGCTACATCTTCCCCGGCGGCTACCTGCACTCGAGCCACGACCT
GCTCGAGGCCATCCACGCCGGCTCGCAAGGCGCGCTGCAGGTCGAGACGGTCGAGAACATCGGGCCGCACTACGT
CCGCACCCTGCGCTGCTGGCGCCAGAACTTCCTGCGCAACTGGCCGGCCACCAGGACCGTCTTCATCGACAAGAA
CCCGGACGCGACCGAGGCCGACGTCGAGGCCTTTCGCCGCCGATGGGAGGTGAGTTGTCCGAGGACGCGGGCAAG
TCGCGATGTTAGGGTTGGCGTTGGCTGACTTGTGGGCGCGCGGGAAAAAAAAAATCGCGACTAGTATTACTTCAC
CTACTGCGAGGCTGGCTTCAGGACGAGGCTGCTCGGGGACCACGTCATTTCGGCCGTCCGGCCCTTTTCGCCCAC
AAACTGTAGACAGCTCGTCGAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail