Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5790
Gene name
LocationContig_292:14497..16502
Strand+
Gene length (bp)2005
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00696 AA_kinase Amino acid kinase family 1.1E-39 15 322
PF01842 ACT ACT domain 1.2E-07 452 505
PF13840 ACT_7 ACT domain 7.8E-09 443 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60163|AK_SCHPO Probable aspartokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.04 PE=1 SV=1 11 509 5.0E-167
sp|P10869|AK_YEAST Aspartokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM3 PE=1 SV=2 6 510 1.0E-156
sp|Q57991|AK_METJA Probable aspartokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0571 PE=1 SV=1 17 509 2.0E-48
sp|O23653|AK2_ARATH Aspartokinase 2, chloroplastic OS=Arabidopsis thaliana GN=AK2 PE=1 SV=2 17 509 2.0E-48
sp|Q9S702|AK3_ARATH Aspartokinase 3, chloroplastic OS=Arabidopsis thaliana GN=AK3 PE=1 SV=1 17 509 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60163|AK_SCHPO Probable aspartokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.04 PE=1 SV=1 11 509 5.0E-167
sp|P10869|AK_YEAST Aspartokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM3 PE=1 SV=2 6 510 1.0E-156
sp|Q57991|AK_METJA Probable aspartokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0571 PE=1 SV=1 17 509 2.0E-48
sp|O23653|AK2_ARATH Aspartokinase 2, chloroplastic OS=Arabidopsis thaliana GN=AK2 PE=1 SV=2 17 509 2.0E-48
sp|Q9S702|AK3_ARATH Aspartokinase 3, chloroplastic OS=Arabidopsis thaliana GN=AK3 PE=1 SV=1 17 509 2.0E-48
sp|Q9LYU8|AK1_ARATH Aspartokinase 1, chloroplastic OS=Arabidopsis thaliana GN=AK1 PE=1 SV=1 17 509 5.0E-48
sp|P27725|AK1H_SERMA Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Serratia marcescens GN=thrA PE=3 SV=1 17 510 5.0E-37
sp|P00561|AK1H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Escherichia coli (strain K12) GN=thrA PE=1 SV=2 156 510 1.0E-36
sp|O81852|AKH2_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH2 PE=1 SV=1 15 509 3.0E-35
sp|P08660|AK3_ECOLI Lysine-sensitive aspartokinase 3 OS=Escherichia coli (strain K12) GN=lysC PE=1 SV=2 16 509 2.0E-34
sp|P49079|AKH1_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Zea mays GN=AKHSDH1 PE=2 SV=1 15 509 2.0E-34
sp|Q9SA18|AKH1_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH1 PE=1 SV=1 15 509 1.0E-33
sp|P49080|AKH2_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Zea mays GN=AKHSDH2 PE=2 SV=1 15 509 4.0E-32
sp|P44505|AKH_HAEIN Bifunctional aspartokinase/homoserine dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrA PE=3 SV=1 160 510 1.0E-31
sp|P57290|AKH_BUCAI Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thrA PE=3 SV=1 156 509 2.0E-31
sp|P37142|AKH_DAUCA Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic (Fragment) OS=Daucus carota PE=1 SV=1 15 509 5.0E-31
sp|Q8K9U9|AKH_BUCAP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrA PE=3 SV=1 156 509 5.0E-28
sp|O69077|AK_PSEAE Aspartokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysC PE=3 SV=2 151 506 9.0E-22
sp|Q89AR4|AKH_BUCBP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrA PE=3 SV=1 155 509 1.0E-21
sp|A4VJB4|AKLYS_PSEU5 Aspartate kinase Ask_LysC OS=Pseudomonas stutzeri (strain A1501) GN=lysC PE=1 SV=1 127 506 3.0E-21
sp|Q88EI9|AK_PSEPK Aspartate kinase OS=Pseudomonas putida (strain KT2440) GN=PP_4473 PE=1 SV=1 127 506 3.0E-21
sp|P94417|AK3_BACSU Aspartokinase 3 OS=Bacillus subtilis (strain 168) GN=yclM PE=1 SV=1 154 509 5.0E-21
sp|C3JXY0|AK_PSEFS Aspartate kinase OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_4747 PE=1 SV=1 151 506 4.0E-19
sp|P53553|AK_GEOSE Aspartokinase OS=Geobacillus stearothermophilus GN=lysC PE=3 SV=1 136 505 9.0E-19
sp|O25827|AK_HELPY Aspartokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysC PE=3 SV=1 127 505 2.0E-18
sp|Q9ZJZ7|AK_HELPJ Aspartokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysC PE=3 SV=1 127 505 2.0E-18
sp|P61489|AK_THETH Aspartokinase OS=Thermus thermophilus GN=ask PE=1 SV=1 136 505 8.0E-17
sp|P61488|AK_THET2 Aspartokinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ask PE=3 SV=1 136 505 8.0E-17
sp|O67221|AK_AQUAE Aspartokinase OS=Aquifex aeolicus (strain VF5) GN=lysC PE=3 SV=1 123 505 9.0E-17
sp|P08495|AK2_BACSU Aspartokinase 2 OS=Bacillus subtilis (strain 168) GN=lysC PE=1 SV=2 136 505 3.0E-15
sp|Q68VZ7|AK_RICTY Aspartokinase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lysC PE=3 SV=1 212 509 2.0E-13
sp|Q59229|AK_BACSG Aspartokinase OS=Bacillus sp. (strain MGA3) GN=lysC PE=1 SV=1 218 505 1.0E-12
sp|Q4UK84|AK_RICFE Aspartokinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lysC PE=3 SV=1 219 509 2.0E-12
sp|P41403|AK_MYCSM Aspartokinase OS=Mycobacterium smegmatis GN=ask PE=3 SV=1 218 505 2.0E-12
sp|Q9ZCI7|AK_RICPR Aspartokinase OS=Rickettsia prowazekii (strain Madrid E) GN=lysC PE=3 SV=1 219 509 2.0E-12
sp|Q04795|AK1_BACSU Aspartokinase 1 OS=Bacillus subtilis (strain 168) GN=dapG PE=3 SV=3 148 505 4.0E-12
sp|Q8RQN1|AK_COREF Aspartokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lysC PE=3 SV=1 150 505 7.0E-12
sp|P26512|AK_CORGL Aspartokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lysC PE=1 SV=2 127 508 2.0E-11
sp|P41398|AK_CORFL Aspartokinase OS=Corynebacterium flavescens GN=lysC PE=1 SV=1 127 508 3.0E-11
sp|Q1RGM9|AK_RICBR Aspartokinase OS=Rickettsia bellii (strain RML369-C) GN=lysC PE=3 SV=1 219 501 3.0E-10
sp|P9WPX3|AK_MYCTU Aspartokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ask PE=1 SV=1 218 505 4.0E-10
sp|P9WPX2|AK_MYCTO Aspartokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ask PE=3 SV=1 218 505 4.0E-10
sp|P0A4Z9|AK_MYCBO Aspartokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ask PE=3 SV=1 218 505 4.0E-10
sp|Q92GF9|AK_RICCN Aspartokinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lysC PE=3 SV=1 219 509 4.0E-10
sp|Q9Z6L0|AK_CHLPN Aspartokinase OS=Chlamydia pneumoniae GN=lysC PE=3 SV=1 145 358 2.0E-09
sp|P00562|AK2H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 2 OS=Escherichia coli (strain K12) GN=metL PE=1 SV=3 148 319 4.0E-09
sp|O84367|AK_CHLTR Aspartokinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lysC PE=3 SV=1 147 509 8.0E-08
sp|Q9PK32|AK_CHLMU Aspartokinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lysC PE=3 SV=1 16 316 5.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6778 0.4422 0.0116 0.2962 0.1417 0.0506 0.0834 0.143 0.0637 0.0958

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup287
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4622
Ophiocordyceps australis 1348a (Ghana) OphauG2|4623
Ophiocordyceps australis map64 (Brazil) OphauB2|3776
Ophiocordyceps australis map64 (Brazil) OphauB2|3777
Ophiocordyceps camponoti-floridani Ophcf2|04773
Ophiocordyceps camponoti-floridani Ophcf2|04774
Ophiocordyceps camponoti-rufipedis Ophun1|34
Ophiocordyceps kimflemingae Ophio5|5735
Ophiocordyceps kimflemingae Ophio5|5736
Ophiocordyceps subramaniannii Hirsu2|5790 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5792

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5790
MGSSTYDNASPHLGWVVQKFGGTSVGKFPDKIAKDIVKSSLSRNRVVVVCSARSTGKKAEGTTSRLLGVYNKLRS
VGPAYADSLEDEPASLADQARSLIRDICNDHIHAAEYFVRDPSLREALSQKIGAECQELIEYVFAAKRFNLEINS
RSKDRVISFGEKLACLFMTALLQDVGVDAEYVDLTDVLHCDTLSQLDVGFYKAAAAAFLRKLEACGSRVPVVTGF
FGNVPGSLIDGDIGRGYTDLCAALCAVGLKAEELQIWKEVDGIFTADPSKVPTARLLPSITPSEAAELTFYGSEV
IHHFTMDQVIRAQPPIPIRIKNVKNPRGNGTIVIPDPVLSAGHQLHRSRPSQTQAFKSPKRPTAVTIKDHISVIN
VHSNKRSISHGFFARVFSILDTHSISVDLISTSEVHVSMAIHSGSTQMEAFAKAKQSLAECGEVSVLSDMAILSL
VGADMKNMIGVAGRMFSTLGEHNVNLEMISQGASEINISCVIDARDATRAMNVLHTHLFTFLE*
Coding >Hirsu2|5790
ATGGGCAGCTCGACCTACGACAATGCGTCGCCGCACCTGGGCTGGGTCGTCCAGAAGTTTGGCGGCACCAGCGTC
GGCAAGTTTCCAGATAAGATCGCCAAAGATATCGTGAAGTCCAGCCTGTCGCGCAATCGCGTCGTTGTCGTATGT
TCGGCCAGGAGCACGGGCAAGAAAGCCGAGGGCACCACCAGTCGGCTTCTCGGCGTCTACAACAAGCTCAGGAGC
GTCGGCCCCGCCTACGCCGACAGCCTCGAAGACGAGCCCGCGTCCCTCGCCGACCAGGCCAGGAGCCTCATCAGA
GATATTTGCAATGACCACATCCACGCCGCCGAGTACTTTGTCCGCGACCCCAGCCTCAGAGAAGCCCTCTCTCAA
AAGATCGGCGCCGAGTGTCAGGAGCTCATCGAGTACGTCTTCGCCGCCAAGCGCTTCAACCTCGAGATCAACTCC
AGATCCAAGGACCGCGTCATCAGCTTCGGCGAGAAGCTGGCTTGCCTCTTCATGACCGCCCTTTTGCAGGACGTG
GGAGTTGACGCCGAATACGTGGACCTGACGGATGTCCTTCATTGCGATACCCTGTCTCAGCTGGATGTCGGCTTC
TACAAGGCCGCCGCGGCCGCCTTCCTGAGGAAGCTCGAGGCGTGCGGGAGCCGCGTGCCCGTCGTCACGGGCTTC
TTCGGCAACGTCCCCGGCAGCCTGATCGACGGCGACATCGGCCGCGGCTACACCGACCTCTGCGCCGCCCTGTGC
GCCGTCGGCCTCAAGGCCGAGGAGCTACAGATCTGGAAGGAGGTCGACGGCATCTTCACCGCCGACCCCTCCAAG
GTGCCCACGGCCCGGCTGCTGCCCTCCATCACGCCGTCCGAGGCGGCCGAGCTGACCTTTTACGGCTCCGAGGTC
ATCCACCACTTCACCATGGACCAGGTCATTCGCGCCCAGCCGCCGATCCCGATCCGCATCAAGAACGTCAAGAAC
CCCCGCGGCAACGGCACCATCGTCATCCCGGACCCCGTCCTGTCGGCGGGCCACCAGCTGCACCGGTCGCGGCCC
TCCCAGACGCAGGCCTTCAAGTCGCCCAAGCGCCCGACGGCCGTCACCATCAAGGACCACATTAGCGTCATCAAC
GTCCACTCCAACAAGCGCTCCATTTCGCACGGCTTCTTCGCCCGCGTCTTCTCCATCCTCGATACCCACTCCATC
TCCGTCGACCTCATCTCCACAAGCGAGGTGCACGTCTCCATGGCCATCCATTCGGGCAGCACCCAGATGGAGGCC
TTCGCAAAGGCCAAGCAGAGCCTGGCCGAGTGCGGCGAAGTCAGCGTCCTTTCCGACATGGCCATCCTGAGCCTC
GTCGGCGCGGACATGAAAAACATGATTGGCGTCGCCGGCCGCATGTTCTCGACTCTCGGCGAACACAACGTCAAT
CTCGAAATGATCTCACAAGGGGCGAGCGAGATCAACATATCCTGCGTGATAGACGCACGGGACGCGACGCGAGCT
ATGAACGTTCTACACACACACCTGTTTACCTTTCTCGAATGA
Transcript >Hirsu2|5790
ATGGGCAGCTCGACCTACGACAATGCGTCGCCGCACCTGGGCTGGGTCGTCCAGAAGTTTGGCGGCACCAGCGTC
GGCAAGTTTCCAGATAAGATCGCCAAAGATATCGTGAAGTCCAGCCTGTCGCGCAATCGCGTCGTTGTCGTATGT
TCGGCCAGGAGCACGGGCAAGAAAGCCGAGGGCACCACCAGTCGGCTTCTCGGCGTCTACAACAAGCTCAGGAGC
GTCGGCCCCGCCTACGCCGACAGCCTCGAAGACGAGCCCGCGTCCCTCGCCGACCAGGCCAGGAGCCTCATCAGA
GATATTTGCAATGACCACATCCACGCCGCCGAGTACTTTGTCCGCGACCCCAGCCTCAGAGAAGCCCTCTCTCAA
AAGATCGGCGCCGAGTGTCAGGAGCTCATCGAGTACGTCTTCGCCGCCAAGCGCTTCAACCTCGAGATCAACTCC
AGATCCAAGGACCGCGTCATCAGCTTCGGCGAGAAGCTGGCTTGCCTCTTCATGACCGCCCTTTTGCAGGACGTG
GGAGTTGACGCCGAATACGTGGACCTGACGGATGTCCTTCATTGCGATACCCTGTCTCAGCTGGATGTCGGCTTC
TACAAGGCCGCCGCGGCCGCCTTCCTGAGGAAGCTCGAGGCGTGCGGGAGCCGCGTGCCCGTCGTCACGGGCTTC
TTCGGCAACGTCCCCGGCAGCCTGATCGACGGCGACATCGGCCGCGGCTACACCGACCTCTGCGCCGCCCTGTGC
GCCGTCGGCCTCAAGGCCGAGGAGCTACAGATCTGGAAGGAGGTCGACGGCATCTTCACCGCCGACCCCTCCAAG
GTGCCCACGGCCCGGCTGCTGCCCTCCATCACGCCGTCCGAGGCGGCCGAGCTGACCTTTTACGGCTCCGAGGTC
ATCCACCACTTCACCATGGACCAGGTCATTCGCGCCCAGCCGCCGATCCCGATCCGCATCAAGAACGTCAAGAAC
CCCCGCGGCAACGGCACCATCGTCATCCCGGACCCCGTCCTGTCGGCGGGCCACCAGCTGCACCGGTCGCGGCCC
TCCCAGACGCAGGCCTTCAAGTCGCCCAAGCGCCCGACGGCCGTCACCATCAAGGACCACATTAGCGTCATCAAC
GTCCACTCCAACAAGCGCTCCATTTCGCACGGCTTCTTCGCCCGCGTCTTCTCCATCCTCGATACCCACTCCATC
TCCGTCGACCTCATCTCCACAAGCGAGGTGCACGTCTCCATGGCCATCCATTCGGGCAGCACCCAGATGGAGGCC
TTCGCAAAGGCCAAGCAGAGCCTGGCCGAGTGCGGCGAAGTCAGCGTCCTTTCCGACATGGCCATCCTGAGCCTC
GTCGGCGCGGACATGAAAAACATGATTGGCGTCGCCGGCCGCATGTTCTCGACTCTCGGCGAACACAACGTCAAT
CTCGAAATGATCTCACAAGGGGCGAGCGAGATCAACATATCCTGCGTGATAGACGCACGGGACGCGACGCGAGCT
ATGAACGTTCTACACACACACCTGTTTACCTTTCTCGAATGA
Gene >Hirsu2|5790
ATGGGCAGCTCGACCTACGACAATGCGTCGCCGCACCTGGGCTGGGTCGTCCAGAAGTTTGGCGGCACCAGCGTC
GGCAAGTTTCCAGATAAGGTGACTCACTCTCCCCTGCACCACCACGTGTGCGCCGTGCCGACGCTAACGGCCTCA
AGATCGCCAAAGATATCGTGAAGTGCGTTGCTGCGACACCCGCCTCTGCCTCGTCGGCGTCTGCTTGGCTGACCT
CTCGTCGTCTTCCAGGTCCAGCCTGTCGCGCAATCGCGTCGTTGTCGTATGTTCGGCCAGGAGCACGGGCAAGAA
AGCCGAGGGCACCACCAGTCGGTCCGTCTCCCCCGTCCCCGTCCTCTCTTGTCTCCCTTTTATCTTCCAAGTCTC
ATCCTCTCCCGTCCTCACGATAGGCTTCTCGGCGTCTACAACAAGCTCAGGAGCGTCGGCCCCGCCTACGCCGAC
AGCCTCGAAGACGAGCCCGCGTCCCTCGCCGACCAGGCCAGGAGCCTCATCAGAGATATTTGCAATGACCACATC
CACGCCGCCGAGTACTTTGTCCGCGACCCCAGCCTCAGAGAAGCCCTCTCTCAAAAGATCGGCGCCGAGTGTCAG
GAGCTCATCGAGTACGTCTTCGCCGCCAAGCGCTTCAACCTCGAGATCAACTCCAGATCCAAGGACCGCGTCATC
AGCTTCGGCGAGAAGCTGGCTTGCCTCTTCATGACCGCCCTTTTGCAGGACGTGGTGCGTACCGGCCCTTTTTTT
CCTTCTTCTGTCCCTGCACTCACTCGGTCGGCCATGATTCACTGAGACTTCCACGGCTCCCCCACTGGCATCTGA
GCTGACAACTATCCTCGCAGGGAGTTGACGCCGAATACGTGGACCTGACGGATGTCCTTCATTGCGATACCCTGT
CTCAGCTGGATGTCGGCTTCTACAAGGCCGCCGCGGCCGCCTTCCTGAGGAAGCTCGAGGCGTGCGGGAGCCGCG
TGCCCGTCGTCACGGGCTTCTTCGGCAACGTCCCCGGCAGCCTGATCGACGGCGACATCGGCCGCGGCTACACCG
ACCTCTGCGCCGCCCTGTGCGCCGTCGGCCTCAAGGCCGAGGAGCTACAGATCTGGAAGGAGGTCGACGGCATCT
TCACCGCCGACCCCTCCAAGGTGCCCACGGCCCGGCTGCTGCCCTCCATCACGCCGTCCGAGGCGGCCGAGCTGA
CCTTTTACGGCTCCGAGGTCATCCACCACTTCACCATGGACCAGGTCATTCGCGCCCAGCCGCCGATCCCGATCC
GCATCAAGAACGTCAAGAACCCCCGCGGCAACGGCACCATCGTCATCCCGGACCCCGTCCTGTCGGCGGGCCACC
AGCTGCACCGGTCGCGGCCCTCCCAGACGCAGGCCTTCAAGTCGCCCAAGCGCCCGACGGCCGTCACCATCAAGG
ACCACATTAGCGTCATCAACGTCCACTCCAACAAGCGCTCCATTTCGCACGGCTTCTTCGCCCGCGTCTTCTCCA
TCCTCGATACCCACTCCATCTCCGTCGACCTCATCTCCACAAGCGAGGTGCACGTCTCCATGGCCATCCATTCGG
GCAGCACCCAGATGGAGGCCTTCGCAAAGGCCAAGCAGAGCCTGGCCGAGTGCGGCGAAGTCAGCGTCCTTTCCG
ACATGGCCATCCTGAGCCTCGTCGGCGCGGACATGAAAAACATGATTGGCGTCGCCGGCCGCATGTTCTCGACTC
TCGGCGAACACAACGTCAATCTCGAAATGATCTCACAAGGTGAGCGCGATCCGTCCTCTTCCTTGCGCCTTCTCC
AACNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCCCCCCTTTATTCATCTAGCCTCGATGTGGGAAAACCTTGGAT
GTTGAGCTGACTGCGCACATCGGAAATTCCAGGGGCGAGCGAGATCAACATATCCTGCGTGATAGACGCACGGGA
CGCGACGCGAGCTATGAACGTTCTACACACACACCTGTTTACCTTTCTCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail