Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5789
Gene name
LocationContig_292:10192..12664
Strand+
Gene length (bp)2472
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02257 RFX_DNA_binding RFX DNA-binding domain 2.8E-27 166 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59V88|RFX1_CANAL Transcriptional regulator RFX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFX1 PE=2 SV=1 104 667 4.0E-60
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 349 661 1.0E-42
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 183 656 6.0E-29
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 150 656 1.0E-28
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 183 656 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59V88|RFX1_CANAL Transcriptional regulator RFX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFX1 PE=2 SV=1 104 667 4.0E-60
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 349 661 1.0E-42
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 183 656 6.0E-29
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 150 656 1.0E-28
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 183 656 4.0E-28
sp|P48381|RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus GN=Rfx3 PE=1 SV=2 183 656 5.0E-28
sp|P48380|RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens GN=RFX3 PE=1 SV=2 183 656 6.0E-28
sp|B1WAV2|RFX2_XENTR DNA-binding protein RFX2 OS=Xenopus tropicalis GN=rfx2 PE=2 SV=1 144 656 9.0E-28
sp|Q32NR3|RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis GN=rfx2 PE=2 SV=1 144 656 1.0E-27
sp|Q4R3Z4|RFX2_MACFA DNA-binding protein RFX2 OS=Macaca fascicularis GN=RFX2 PE=2 SV=1 183 657 2.0E-27
sp|Q5RDR2|RFX2_PONAB DNA-binding protein RFX2 OS=Pongo abelii GN=RFX2 PE=2 SV=1 183 657 4.0E-27
sp|P48378|RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens GN=RFX2 PE=2 SV=2 183 657 8.0E-27
sp|P48379|RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus GN=Rfx2 PE=1 SV=2 183 657 1.0E-26
sp|B2GV50|RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus GN=Rfx2 PE=1 SV=1 172 657 2.0E-26
sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus GN=RFX2 PE=2 SV=1 183 657 2.0E-26
sp|A0JMF8|RFX3_DANRE Transcription factor RFX3 OS=Danio rerio GN=rfx3 PE=2 SV=1 147 656 2.0E-26
sp|Q5EAP5|RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio GN=rfx2 PE=2 SV=1 183 656 4.0E-26
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 117 241 1.0E-23
sp|Q09555|DAF19_CAEEL RFX-like transcription factor daf-19 OS=Caenorhabditis elegans GN=daf-19 PE=2 SV=3 159 656 2.0E-23
sp|P48743|RFX1_YEAST RFX-like DNA-binding protein RFX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFX1 PE=1 SV=2 160 245 5.0E-20
sp|Q5RJA1|RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio GN=rfx6 PE=2 SV=2 162 666 1.0E-16
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 358 656 6.0E-14
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 150 249 6.0E-13
sp|Q6ZV50|RFX8_HUMAN DNA-binding protein RFX8 OS=Homo sapiens GN=RFX8 PE=2 SV=2 157 236 2.0E-11
sp|D3YU81|RFX8_MOUSE DNA-binding protein RFX8 OS=Mus musculus GN=Rfx8 PE=3 SV=1 173 236 2.0E-10
sp|Q33E94|RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens GN=RFX4 PE=1 SV=2 172 243 7.0E-10
sp|Q7TNK1|RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus GN=Rfx4 PE=1 SV=1 172 243 7.0E-10
sp|Q2KHR2|RFX7_HUMAN DNA-binding protein RFX7 OS=Homo sapiens GN=RFX7 PE=1 SV=1 161 236 2.0E-09
sp|A2BGA0|RFX4_DANRE Transcription factor RFX4 OS=Danio rerio GN=rfx4 PE=2 SV=1 172 243 2.0E-09
sp|D2HNW6|RFX6_AILME DNA-binding protein RFX6 OS=Ailuropoda melanoleuca GN=RFX6 PE=3 SV=2 162 243 5.0E-09
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN=RFX6 PE=1 SV=2 162 243 5.0E-09
sp|Q8C7R7|RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus GN=Rfx6 PE=1 SV=2 162 243 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
RFX DNA-binding domain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5789
MDHVGFADVSGMYAGQWIASDHKSINPAPQMSAEDIILHATTHMQSANPDFPLDGPMSAAPVAHAHIAYQQQQHP
MARHPLPTEQYTGTASFAESDSQMLDRDDNDDGESMAGAAGMSRPAASRSSANNELEMRQLFGANRHRTLQDVAG
ELHGNERGPNSERTRQVFAMLWINSVCSKGKGSVPRGRVYANYASRCATERITVLNPASFGKLVRVLFPGLKTRR
LGVRGESKYHYVNFALAEDQPEIREPQPPPPRPLPEAKAFSQTFTAFSQPNGVTGRGPSPPPRDVGPGRKKSDAG
SKTHGRTHSLYNQPDLGSIDNMRSTSTKTQLELAFPSAMEQSVQQSEPLALPPIEAYLPPGTDPDAAKSLSALYR
SHCTSLVECIRYCREKTFFHLYTSFQGTLTMPVQKLFANGALAAWIEGCDYALYQRMMSIIASLTLQVVPKPVLD
TLRNIAERLVPHIRESFQGQPQHVLAAKEAPAAIFAGLLDRALRVNLTAHAAANMLSNPANRDQMYVDWITMIRA
RKIAECVPTRGMDDVVDVLLAEMRDLLDPINVPWEVECLTIYGDVASRNGRQASESNGGDDSGHNVLDRWVSFLQ
GLPDKFPYASHTDIVWCVERVGTAVMRDLTLSQGKSFGTWWVTKTWVDEMVRFLAEQGGFMKQKAQQPSSSVGVL
PEEAAKEDSRHDSRYSRSGSSRSRSSSEDANLSNMSQTQPGRAPFPTPVQPPQGGSTQAAISMSGNDPHDDSGIG
IRTPDDDFPMDKFGFTGPENMGIVAGAELATA*
Coding >Hirsu2|5789
ATGGACCACGTCGGCTTCGCCGACGTCTCGGGCATGTACGCCGGGCAATGGATCGCCAGCGACCACAAGAGCATC
AATCCGGCGCCCCAGATGTCGGCCGAGGACATCATCCTGCACGCTACCACCCACATGCAATCCGCCAATCCCGAC
TTCCCTCTGGACGGGCCTATGTCAGCAGCCCCCGTCGCCCATGCTCACATCGCCTACCAGCAGCAACAGCATCCC
ATGGCCAGACACCCGCTCCCGACCGAGCAGTACACCGGGACCGCAAGCTTCGCCGAGAGCGACAGTCAGATGCTG
GATCGTGATGACAACGACGATGGCGAATCCATGGCCGGCGCTGCTGGCATGTCCCGCCCCGCGGCATCGAGATCG
AGTGCGAACAACGAGCTGGAGATGAGGCAGCTCTTCGGAGCCAATCGGCATCGCACCCTGCAGGACGTTGCCGGC
GAGCTCCACGGCAACGAGCGAGGGCCCAACTCGGAGCGCACTCGCCAGGTCTTTGCCATGCTTTGGATCAACTCG
GTTTGTTCCAAGGGCAAGGGTTCCGTGCCCCGAGGCCGAGTATACGCCAACTACGCATCACGATGCGCAACCGAG
AGAATCACGGTCCTCAACCCCGCCAGCTTCGGAAAGCTCGTCCGGGTCCTCTTCCCCGGACTAAAGACCCGTCGT
CTGGGGGTCCGTGGAGAGTCCAAGTACCACTACGTCAATTTTGCGCTCGCCGAGGATCAACCCGAGATCAGAGAG
CCTCAGCCACCGCCCCCGAGGCCACTACCCGAGGCCAAGGCGTTCTCGCAAACCTTCACGGCATTTTCGCAGCCG
AATGGCGTCACGGGGCGCGGTCCATCGCCGCCACCTCGAGATGTCGGTCCAGGCCGGAAAAAAAGCGACGCGGGC
TCCAAGACACATGGCCGGACTCATAGTCTGTATAATCAGCCGGACCTGGGGAGCATCGACAACATGCGCTCCACC
TCGACCAAGACGCAGCTGGAGCTGGCATTCCCGTCTGCGATGGAGCAAAGCGTCCAGCAATCGGAACCGCTCGCG
CTGCCCCCGATCGAGGCTTACCTGCCTCCGGGAACCGACCCCGATGCCGCCAAGTCTTTGTCAGCTCTGTATCGA
TCACACTGTACGTCGCTGGTCGAGTGTATCAGATACTGCCGGGAGAAGACCTTCTTTCATCTCTACACCTCTTTC
CAAGGCACACTCACGATGCCGGTGCAGAAGCTGTTTGCGAATGGCGCACTAGCAGCTTGGATCGAGGGTTGCGAC
TATGCCCTGTACCAGCGCATGATGAGCATCATCGCCAGCCTGACACTGCAGGTCGTGCCGAAGCCAGTGCTTGAT
ACGCTTCGCAACATAGCGGAACGACTGGTACCACACATACGCGAGTCCTTCCAAGGCCAACCACAACATGTGCTC
GCGGCTAAGGAGGCGCCAGCCGCCATCTTTGCCGGGCTCCTCGATCGAGCTCTCCGCGTCAACCTGACGGCTCAC
GCCGCGGCCAACATGCTGTCGAACCCGGCCAACCGAGATCAGATGTACGTCGACTGGATCACCATGATACGAGCA
CGAAAGATAGCCGAGTGCGTGCCAACACGCGGCATGGACGACGTGGTGGACGTCTTGCTGGCGGAAATGCGTGAC
CTGCTCGACCCAATCAATGTGCCTTGGGAGGTGGAATGCCTGACAATCTACGGGGACGTGGCATCCCGAAACGGG
CGGCAGGCGAGCGAGAGCAACGGGGGCGACGACTCGGGCCACAACGTGCTGGACCGATGGGTGAGCTTCCTGCAA
GGTCTGCCGGACAAGTTCCCGTACGCCTCGCACACGGACATTGTCTGGTGCGTGGAACGGGTCGGGACAGCGGTG
ATGCGAGACCTCACGCTTTCTCAGGGCAAGAGTTTCGGCACGTGGTGGGTGACGAAGACGTGGGTGGATGAGATG
GTCCGTTTTCTGGCCGAGCAGGGCGGCTTCATGAAGCAAAAGGCGCAGCAGCCCAGCTCGAGCGTCGGTGTGCTG
CCGGAAGAGGCCGCCAAGGAAGACAGCCGGCACGACTCGCGATACAGCCGCAGCGGCAGCAGCAGGAGCAGGAGC
AGTAGCGAGGACGCGAACCTATCCAATATGTCGCAGACGCAGCCGGGGCGTGCACCGTTCCCGACACCAGTACAG
CCGCCCCAGGGCGGCAGCACGCAGGCGGCGATAAGCATGAGCGGCAACGACCCTCACGATGATAGCGGGATAGGA
ATCCGGACGCCAGACGACGACTTCCCCATGGACAAATTCGGCTTCACGGGGCCCGAGAATATGGGCATAGTGGCC
GGCGCAGAGCTGGCGACGGCCTGA
Transcript >Hirsu2|5789
ATGGACCACGTCGGCTTCGCCGACGTCTCGGGCATGTACGCCGGGCAATGGATCGCCAGCGACCACAAGAGCATC
AATCCGGCGCCCCAGATGTCGGCCGAGGACATCATCCTGCACGCTACCACCCACATGCAATCCGCCAATCCCGAC
TTCCCTCTGGACGGGCCTATGTCAGCAGCCCCCGTCGCCCATGCTCACATCGCCTACCAGCAGCAACAGCATCCC
ATGGCCAGACACCCGCTCCCGACCGAGCAGTACACCGGGACCGCAAGCTTCGCCGAGAGCGACAGTCAGATGCTG
GATCGTGATGACAACGACGATGGCGAATCCATGGCCGGCGCTGCTGGCATGTCCCGCCCCGCGGCATCGAGATCG
AGTGCGAACAACGAGCTGGAGATGAGGCAGCTCTTCGGAGCCAATCGGCATCGCACCCTGCAGGACGTTGCCGGC
GAGCTCCACGGCAACGAGCGAGGGCCCAACTCGGAGCGCACTCGCCAGGTCTTTGCCATGCTTTGGATCAACTCG
GTTTGTTCCAAGGGCAAGGGTTCCGTGCCCCGAGGCCGAGTATACGCCAACTACGCATCACGATGCGCAACCGAG
AGAATCACGGTCCTCAACCCCGCCAGCTTCGGAAAGCTCGTCCGGGTCCTCTTCCCCGGACTAAAGACCCGTCGT
CTGGGGGTCCGTGGAGAGTCCAAGTACCACTACGTCAATTTTGCGCTCGCCGAGGATCAACCCGAGATCAGAGAG
CCTCAGCCACCGCCCCCGAGGCCACTACCCGAGGCCAAGGCGTTCTCGCAAACCTTCACGGCATTTTCGCAGCCG
AATGGCGTCACGGGGCGCGGTCCATCGCCGCCACCTCGAGATGTCGGTCCAGGCCGGAAAAAAAGCGACGCGGGC
TCCAAGACACATGGCCGGACTCATAGTCTGTATAATCAGCCGGACCTGGGGAGCATCGACAACATGCGCTCCACC
TCGACCAAGACGCAGCTGGAGCTGGCATTCCCGTCTGCGATGGAGCAAAGCGTCCAGCAATCGGAACCGCTCGCG
CTGCCCCCGATCGAGGCTTACCTGCCTCCGGGAACCGACCCCGATGCCGCCAAGTCTTTGTCAGCTCTGTATCGA
TCACACTGTACGTCGCTGGTCGAGTGTATCAGATACTGCCGGGAGAAGACCTTCTTTCATCTCTACACCTCTTTC
CAAGGCACACTCACGATGCCGGTGCAGAAGCTGTTTGCGAATGGCGCACTAGCAGCTTGGATCGAGGGTTGCGAC
TATGCCCTGTACCAGCGCATGATGAGCATCATCGCCAGCCTGACACTGCAGGTCGTGCCGAAGCCAGTGCTTGAT
ACGCTTCGCAACATAGCGGAACGACTGGTACCACACATACGCGAGTCCTTCCAAGGCCAACCACAACATGTGCTC
GCGGCTAAGGAGGCGCCAGCCGCCATCTTTGCCGGGCTCCTCGATCGAGCTCTCCGCGTCAACCTGACGGCTCAC
GCCGCGGCCAACATGCTGTCGAACCCGGCCAACCGAGATCAGATGTACGTCGACTGGATCACCATGATACGAGCA
CGAAAGATAGCCGAGTGCGTGCCAACACGCGGCATGGACGACGTGGTGGACGTCTTGCTGGCGGAAATGCGTGAC
CTGCTCGACCCAATCAATGTGCCTTGGGAGGTGGAATGCCTGACAATCTACGGGGACGTGGCATCCCGAAACGGG
CGGCAGGCGAGCGAGAGCAACGGGGGCGACGACTCGGGCCACAACGTGCTGGACCGATGGGTGAGCTTCCTGCAA
GGTCTGCCGGACAAGTTCCCGTACGCCTCGCACACGGACATTGTCTGGTGCGTGGAACGGGTCGGGACAGCGGTG
ATGCGAGACCTCACGCTTTCTCAGGGCAAGAGTTTCGGCACGTGGTGGGTGACGAAGACGTGGGTGGATGAGATG
GTCCGTTTTCTGGCCGAGCAGGGCGGCTTCATGAAGCAAAAGGCGCAGCAGCCCAGCTCGAGCGTCGGTGTGCTG
CCGGAAGAGGCCGCCAAGGAAGACAGCCGGCACGACTCGCGATACAGCCGCAGCGGCAGCAGCAGGAGCAGGAGC
AGTAGCGAGGACGCGAACCTATCCAATATGTCGCAGACGCAGCCGGGGCGTGCACCGTTCCCGACACCAGTACAG
CCGCCCCAGGGCGGCAGCACGCAGGCGGCGATAAGCATGAGCGGCAACGACCCTCACGATGATAGCGGGATAGGA
ATCCGGACGCCAGACGACGACTTCCCCATGGACAAATTCGGCTTCACGGGGCCCGAGAATATGGGCATAGTGGCC
GGCGCAGAGCTGGCGACGGCCTGA
Gene >Hirsu2|5789
ATGGACCACGTCGGCTTCGCCGACGTCTCGGGCATGTACGCCGGGCAATGGATCGCCAGCGACCACAAGAGCATC
AATCCGGCGCCCCAGATGTCGGCCGAGGACATCATCCTGCACGCTACCACCCACATGCAATCCGCCAATCCCGAC
TTCCCTCTGGACGGGCCTATGTCAGCAGCCCCCGTCGCCCATGCTCACATCGCCTACCAGCAGCAACAGCATCCC
ATGGCCAGACACCCGCTCCCGACCGAGCAGTACACCGGGACCGCAAGCTTCGCCGAGAGCGACAGTCAGATGCTG
GATCGTGATGACAACGACGATGGCGAATCCATGGCCGGCGCTGCTGGCATGTCCCGCCCCGCGGCATCGAGATCG
AGTGCGAACAACGAGCTGGAGATGAGGCAGCTCTTCGGAGCCAATCGGCATCGCACCCTGCAGGACGTTGCCGGC
GAGCTCCACGGCAACGAGCGAGGGCCCAACTCGGAGCGCACTCGCCAGGTCTTTGCCATGCTTTGGTACGCACAA
CACTTCTTCCAGGAGTTCCGTGCCTGTACAAGCTGACTCGCCTCCCTAGGATCAACTCGGTTTGTTCCAAGGGCA
AGGGTTCCGTGCCCCGAGGCCGAGTATACGCCAACTACGCATCACGATGCGCAACCGAGAGAATCACGGTCCTCA
ACCCCGCCAGCTTCGGAAAGCTCGTCCGGGTCCTCTTCCCCGGACTAAAGACCCGTCGTCTGGGGGTCCGTGGAG
AGTCCAAGTACCACTACGTCAATTTTGCGCTCGCCGAGGATCAACCCGAGATCAGAGAGCCTCAGCCACCGCCCC
CGAGGCCACTACCCGAGGCCAAGGCGTTCTCGCAAACCTTCACGTGCGTATCCTAGGAGAAATGGGCGACAGCCA
GCGGCCTCGTTTTTCTGACTCGCAATGAACAGGGCATTTTCGCAGCCGAATGGCGTCACGGGGCGCGGTCCATCG
CCGCCACCTCGAGATGTCGGTCCAGGCCGGAAAAAAAGCGACGCGGGCTCCAAGACACATGGCCGGACTCATAGT
CTGTATAATCAGCCGGACCTGGGGAGCATCGACAACATGCGCTCCACCTCGACCAAGACGCAGCTGGAGCTGGCA
TTCCCGTCTGCGATGGAGCAAAGCGTCCAGCAATCGGAACCGCTCGCGCTGCCCCCGATCGAGGCTTACCTGCCT
CCGGGAACCGACCCCGATGCCGCCAAGTCTTTGTCAGCTCTGTATCGATCACACTGTACGTCGCTGGTCGAGTGT
ATCAGATACTGCCGGGAGAAGACCTTCTTTCATCTCTACACCTCTTTCCAAGGCACACTCACGATGCCGGTGCAG
AAGCTGTTTGCGAATGGCGCACTAGCAGCTTGGATCGAGGGTTGCGACTATGCCCTGTACCAGCGCATGATGAGC
ATCATCGCCAGCCTGACACTGCAGGTCGTGCCGAAGCCAGTGCTTGATACGCTTCGCAACATAGCGGAACGACTG
GTACCACACATACGCGAGTCCTTCCAAGGCCAACCACAACATGTGCTCGCGGCTAAGGAGGCGCCAGCCGCCATC
TTTGCCGGGCTCCTCGATCGAGCTCTCCGCGTCAACCTGACGGCTCACGCCGCGGCCAACATGCTGTCGAACCCG
GCCAACCGAGATCAGATGTACGTCGACTGGATCACCATGATACGAGCACGAAAGATAGCCGAGTGCGTGCCAACA
CGCGGCATGGACGACGTGGTGGACGTCTTGCTGGCGGAAATGCGTGACCTGCTCGACCCAATCAATGTGCCTTGG
GAGGTGGAATGCCTGACAATCTACGGGGACGTGGCATCCCGAAACGGGCGGCAGGCGAGCGAGAGCAACGGGGGC
GACGACTCGGGCCACAACGTGCTGGACCGATGGGTGAGCTTCCTGCAAGGTCTGCCGGACAAGTTCCCGTACGCC
TCGCACACGGACATTGTCTGGTGCGTGGAACGGGTCGGGACAGCGGTGATGCGAGACCTCACGCTTTCTCAGGGC
AAGAGTTTCGGCACGTGGTGGGTGACGAAGACGTGGGTGGATGAGATGGTCCGTTTTCTGGCCGAGCAGGGCGGC
TTCATGAAGCAAAAGGCGCAGCAGCCCAGCTCGAGCGTCGGTGTGCTGCCGGAAGAGGCCGCCAAGGAAGACAGC
CGGCACGACTCGCGATACAGCCGCAGCGGCAGCAGCAGGAGCAGGAGCAGTAGCGAGGACGCGAACCTATCCAAT
ATGTCGCAGACGCAGCCGGGGCGTGCACCGTTCCCGACACCAGTACAGCCGCCCCAGGGCGGCAGCACGCAGGCG
GCGATAAGCATGAGCGGCAACGACCCTCACGATGATAGCGGGATAGGAATCCGGACGCCAGACGACGACTTCCCC
ATGGACAAATTCGGCTTCACGGGGCCCGAGAATATGGGCATAGTGGCCGGCGCAGAGCTGGCGACGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail