Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5787
Gene name
LocationContig_292:3907..5785
Strand-
Gene length (bp)1878
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12929 Mid1 Stretch-activated Ca2+-permeable channel component 7.5E-143 127 574

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10063|EHS1_SCHPO Calcium influx-promoting protein ehs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehs1 PE=3 SV=1 210 585 2.0E-54
sp|P41821|MID1_YEAST Stretch-activated cation channel MID1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MID1 PE=1 SV=1 201 575 1.0E-39

GO

GO Term Description Terminal node
GO:0005262 calcium channel activity Yes
GO:0098703 calcium ion import across plasma membrane Yes
GO:0060402 calcium ion transport into cytosol No
GO:0098660 inorganic ion transmembrane transport No
GO:0022838 substrate-specific channel activity No
GO:0015085 calcium ion transmembrane transporter activity No
GO:0072503 cellular divalent inorganic cation homeostasis No
GO:0055080 cation homeostasis No
GO:0055082 cellular chemical homeostasis No
GO:0065007 biological regulation No
GO:0098659 inorganic cation import across plasma membrane No
GO:0006811 ion transport No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0060401 cytosolic calcium ion transport No
GO:0005215 transporter activity No
GO:0015267 channel activity No
GO:0065008 regulation of biological quality No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0007204 positive regulation of cytosolic calcium ion concentration No
GO:0098739 import across plasma membrane No
GO:0042592 homeostatic process No
GO:0098662 inorganic cation transmembrane transport No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0006874 cellular calcium ion homeostasis No
GO:0051649 establishment of localization in cell No
GO:0050801 ion homeostasis No
GO:0006873 cellular ion homeostasis No
GO:1902656 calcium ion import into cytosol No
GO:0034220 ion transmembrane transport No
GO:0051480 regulation of cytosolic calcium ion concentration No
GO:0009987 cellular process No
GO:0099587 inorganic ion import across plasma membrane No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0098771 inorganic ion homeostasis No
GO:0019725 cellular homeostasis No
GO:0022803 passive transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006816 calcium ion transport No
GO:0030003 cellular cation homeostasis No
GO:0098655 cation transmembrane transport No
GO:0055074 calcium ion homeostasis No
GO:0072507 divalent inorganic cation homeostasis No
GO:0008324 cation transmembrane transporter activity No
GO:0070588 calcium ion transmembrane transport No
GO:0072511 divalent inorganic cation transport No
GO:0005216 ion channel activity No
GO:0098657 import into cell No
GO:0055065 metal ion homeostasis No
GO:0048878 chemical homeostasis No
GO:0005261 cation channel activity No
GO:0006812 cation transport No
GO:0070509 calcium ion import No
GO:0070838 divalent metal ion transport No
GO:0055085 transmembrane transport No
GO:0051179 localization No
GO:0006875 cellular metal ion homeostasis No
GO:0097553 calcium ion transmembrane import into cytosol No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5787
MLSSPQPSRLGALLVLLALDLLLFLPSVAQAADALLASNGPPSVPYELVDPQPELTYNPKFALFDRSIIGRAPPG
VTALTKNEPMALNLQPGSTACFMVERSLLLGNDGDSAANRPSQNAQASPKSLYLSANTCLQPAHKASDSKILTPP
QLVLSVSNSSQVACQQQTLEPKESQGRVFTEGAVVYGLNATGDVFIGVTAPNVSTDFAGVYNFELAASVDGYFHR
YENRTGAQVLWMDSDSTSALLVTRNLTENKGDVQRIMDQDPPFGLFIIRKDAPTSAGLMHSVCGLRNTALIQGNH
LSNSLLNSPMTTAMTLRGPGGFPKQQFHLVGLNASTPYIGVPVRESSNSGLGKRQAGNVGAGSVVFSATEFQTVS
GTNCKMVTDLKFCDEIQYAVPGNDNKFNNTALARAYDDYARKVYDNFDKAMMQIPCETPSTSRYSLTRTCDDCKA
AYKKWLCTIVMPRCEDFRSGNEFAMVRNVWQPFPNGTRLPDEEKNRLGQRPWMNASRTRFVDDEIEPGPYKEILP
CEDICYEVVQSCPANLQFTCPQPGMLSFNHSYGQRDVNGSTVSCNYPGEARTRMSGAAALLPDLIRLGAISLFAT
AVLTVR*
Coding >Hirsu2|5787
ATGCTCTCGAGTCCCCAGCCTTCGCGGCTGGGGGCGCTTCTGGTGCTTCTTGCTCTCGATCTGCTCCTCTTCTTG
CCGAGCGTCGCCCAGGCCGCTGATGCGCTCCTCGCCTCGAACGGCCCGCCGTCCGTGCCCTACGAGCTGGTCGAT
CCCCAGCCCGAACTGACATACAATCCGAAATTCGCCCTTTTCGACCGGAGTATCATAGGGCGAGCACCGCCTGGC
GTGACGGCTCTCACCAAGAACGAGCCCATGGCTCTGAATTTGCAACCTGGCTCAACAGCTTGCTTCATGGTCGAA
AGAAGTCTACTGCTTGGAAATGACGGCGACAGTGCAGCCAATCGGCCATCACAGAATGCGCAGGCGTCTCCCAAG
AGCCTCTACCTGTCCGCCAACACTTGTCTGCAGCCGGCACACAAAGCTTCGGACAGCAAGATATTGACGCCTCCA
CAACTTGTACTTTCCGTTTCCAATTCGAGCCAGGTCGCTTGTCAGCAGCAAACGTTGGAGCCCAAAGAGAGTCAG
GGCAGGGTCTTCACCGAGGGCGCTGTCGTGTACGGCCTCAACGCCACCGGAGACGTGTTCATCGGCGTCACGGCC
CCAAATGTGTCAACAGACTTCGCGGGGGTGTATAACTTTGAGCTGGCGGCGTCCGTTGATGGCTACTTTCACCGG
TACGAAAATCGCACCGGCGCCCAGGTCTTGTGGATGGATAGCGACTCGACGTCCGCCTTACTTGTCACCAGAAAC
CTGACGGAGAACAAGGGGGACGTCCAGCGCATCATGGATCAAGATCCCCCCTTTGGGCTCTTCATCATTAGAAAA
GACGCGCCGACCAGTGCTGGCTTGATGCACTCAGTCTGCGGACTGCGGAACACGGCCCTGATCCAAGGGAATCAC
CTCAGCAACAGCTTGTTGAATAGCCCCATGACGACGGCCATGACGCTTCGGGGGCCGGGGGGTTTCCCAAAGCAG
CAGTTCCACCTCGTCGGGCTCAATGCAAGCACTCCCTATATAGGCGTCCCGGTCAGGGAATCGAGCAACAGCGGC
CTCGGGAAAAGGCAGGCCGGCAATGTCGGGGCAGGGAGCGTCGTCTTCTCGGCCACAGAATTCCAGACAGTATCA
GGGACAAACTGCAAAATGGTAACGGACCTGAAGTTTTGCGACGAGATACAGTACGCGGTACCGGGGAACGACAAC
AAATTTAATAACACGGCGCTGGCCAGGGCGTACGACGATTACGCGAGAAAAGTGTACGACAATTTTGACAAAGCC
ATGATGCAGATCCCGTGCGAAACACCGAGCACGTCACGGTATTCACTGACGCGTACCTGCGACGACTGCAAGGCG
GCATACAAGAAATGGCTGTGCACAATCGTCATGCCGCGGTGCGAGGATTTTCGGAGCGGCAACGAGTTTGCTATG
GTACGCAACGTCTGGCAGCCCTTCCCCAATGGCACACGGCTTCCGGATGAGGAGAAGAACAGGCTGGGCCAGAGG
CCATGGATGAACGCGTCGCGCACCCGCTTCGTCGACGATGAGATCGAACCTGGTCCGTACAAAGAAATCCTGCCA
TGCGAGGACATATGCTACGAGGTGGTGCAGAGCTGCCCGGCCAATCTTCAGTTCACATGCCCGCAGCCAGGCATG
TTGAGCTTCAATCACAGCTATGGACAGCGAGACGTCAACGGGTCGACGGTTTCGTGCAACTACCCTGGTGAAGCG
CGGACGCGCATGAGCGGCGCCGCGGCACTGCTGCCAGACCTGATACGACTTGGCGCTATTTCCTTGTTCGCGACG
GCTGTTCTGACGGTCAGGTGA
Transcript >Hirsu2|5787
ATGCTCTCGAGTCCCCAGCCTTCGCGGCTGGGGGCGCTTCTGGTGCTTCTTGCTCTCGATCTGCTCCTCTTCTTG
CCGAGCGTCGCCCAGGCCGCTGATGCGCTCCTCGCCTCGAACGGCCCGCCGTCCGTGCCCTACGAGCTGGTCGAT
CCCCAGCCCGAACTGACATACAATCCGAAATTCGCCCTTTTCGACCGGAGTATCATAGGGCGAGCACCGCCTGGC
GTGACGGCTCTCACCAAGAACGAGCCCATGGCTCTGAATTTGCAACCTGGCTCAACAGCTTGCTTCATGGTCGAA
AGAAGTCTACTGCTTGGAAATGACGGCGACAGTGCAGCCAATCGGCCATCACAGAATGCGCAGGCGTCTCCCAAG
AGCCTCTACCTGTCCGCCAACACTTGTCTGCAGCCGGCACACAAAGCTTCGGACAGCAAGATATTGACGCCTCCA
CAACTTGTACTTTCCGTTTCCAATTCGAGCCAGGTCGCTTGTCAGCAGCAAACGTTGGAGCCCAAAGAGAGTCAG
GGCAGGGTCTTCACCGAGGGCGCTGTCGTGTACGGCCTCAACGCCACCGGAGACGTGTTCATCGGCGTCACGGCC
CCAAATGTGTCAACAGACTTCGCGGGGGTGTATAACTTTGAGCTGGCGGCGTCCGTTGATGGCTACTTTCACCGG
TACGAAAATCGCACCGGCGCCCAGGTCTTGTGGATGGATAGCGACTCGACGTCCGCCTTACTTGTCACCAGAAAC
CTGACGGAGAACAAGGGGGACGTCCAGCGCATCATGGATCAAGATCCCCCCTTTGGGCTCTTCATCATTAGAAAA
GACGCGCCGACCAGTGCTGGCTTGATGCACTCAGTCTGCGGACTGCGGAACACGGCCCTGATCCAAGGGAATCAC
CTCAGCAACAGCTTGTTGAATAGCCCCATGACGACGGCCATGACGCTTCGGGGGCCGGGGGGTTTCCCAAAGCAG
CAGTTCCACCTCGTCGGGCTCAATGCAAGCACTCCCTATATAGGCGTCCCGGTCAGGGAATCGAGCAACAGCGGC
CTCGGGAAAAGGCAGGCCGGCAATGTCGGGGCAGGGAGCGTCGTCTTCTCGGCCACAGAATTCCAGACAGTATCA
GGGACAAACTGCAAAATGGTAACGGACCTGAAGTTTTGCGACGAGATACAGTACGCGGTACCGGGGAACGACAAC
AAATTTAATAACACGGCGCTGGCCAGGGCGTACGACGATTACGCGAGAAAAGTGTACGACAATTTTGACAAAGCC
ATGATGCAGATCCCGTGCGAAACACCGAGCACGTCACGGTATTCACTGACGCGTACCTGCGACGACTGCAAGGCG
GCATACAAGAAATGGCTGTGCACAATCGTCATGCCGCGGTGCGAGGATTTTCGGAGCGGCAACGAGTTTGCTATG
GTACGCAACGTCTGGCAGCCCTTCCCCAATGGCACACGGCTTCCGGATGAGGAGAAGAACAGGCTGGGCCAGAGG
CCATGGATGAACGCGTCGCGCACCCGCTTCGTCGACGATGAGATCGAACCTGGTCCGTACAAAGAAATCCTGCCA
TGCGAGGACATATGCTACGAGGTGGTGCAGAGCTGCCCGGCCAATCTTCAGTTCACATGCCCGCAGCCAGGCATG
TTGAGCTTCAATCACAGCTATGGACAGCGAGACGTCAACGGGTCGACGGTTTCGTGCAACTACCCTGGTGAAGCG
CGGACGCGCATGAGCGGCGCCGCGGCACTGCTGCCAGACCTGATACGACTTGGCGCTATTTCCTTGTTCGCGACG
GCTGTTCTGACGGTCAGGTGA
Gene >Hirsu2|5787
ATGCTCTCGAGTCCCCAGCCTTCGCGGCTGGGGGCGCTTCTGGTGCTTCTTGCTCTCGATCTGCTCCTCTTCTTG
CCGAGCGTCGCCCAGGCCGCTGATGCGCTCCTCGCCTCGAACGGCCCGCCGTCCGTGCCCTACGAGCTGGTCGAT
CCCCAGCCCGAACTGACATACAATCCGAAATTCGCCCTTTTCGACCGGAGTATCATAGGGCGAGCACCGCCTGGC
GTGACGGCTCTCACCAAGAACGAGCCCATGGCTCTGAATTTGCAACCTGGCTCAACAGCTTGCTTCATGGTCGAA
AGAAGTCTACTGCTTGGAAATGACGGCGACAGTGCAGCCAATCGGCCATCACAGAATGCGCAGGCGTCTCCCAAG
AGCCTCTACCTGTCCGCCAACACTTGTCTGCAGCCGGCACACAAAGCTTCGGACAGCAAGATATTGACGCCTCCA
CAACTTGTACTTTCCGTTTCCAATTCGAGCCAGGTCGCTTGTCAGCAGCAAACGTTGGAGCCCAAAGAGAGTCAG
GGCAGGGTCTTCACCGAGGGCGCTGTCGTGTACGGCCTCAACGCCACCGGAGACGTGTTCATCGGCGTCACGGCC
CCAAATGTGTCAACAGACTTCGCGGGGGTGTATAACTTTGAGCTGGCGGCGTCCGTTGATGGCTACTTTCACCGG
TACGAAAATCGCACCGGCGCCCAGGTCTTGTGGATGGATAGCGACTCGACGTCCGCCTTACTTGTCACCAGAAAC
CTGACGGAGAACAAGGGGGACGTCCAGCGCATCATGGATCAAGATCCCCCCTTTGGGCTCTTCATCATTAGAAAA
GACGCGCCGACCAGTGCTGGCTTGATGCACTCAGTCTGCGGACTGCGGAACACGGCCCTGATCCAAGGGAATCAC
CTCAGCAACAGCTTGTTGAATAGCCCCATGACGACGGCCATGACGCTTCGGGGGCCGGGGGGTTTCCCAAAGCAG
CAGTTCCACCTCGTCGGGCTCAATGCAAGCACTCCCTATATAGGCGTCCCGGTCAGGGAATCGAGCAACAGCGGC
CTCGGGAAAAGGCAGGCCGGCAATGTCGGGGCAGGGAGCGTCGTCTTCTCGGCCACAGAATTCCAGACAGTATCA
GGTAGGCGATAGCCTGGGGCAGAGGGGGCCGAACAATGGCGCTGACACGGCGGCTCAGGGACAAACTGCAAAATG
GTAACGGACCTGAAGTTTTGCGACGAGATACAGTACGCGGTACCGGGGAACGACAACAAATTTAATAACACGGCG
CTGGCCAGGGCGTACGACGATTACGCGAGAAAAGTGTACGACAATTTTGACAAAGCCATGATGCAGATCCCGTGC
GAAACACCGAGCACGTCACGGTATTCACTGACGCGTACCTGCGACGACTGCAAGGCGGCATACAAGAAATGGCTG
TGCACAATCGTCATGCCGCGGTGCGAGGATTTTCGGAGCGGCAACGAGTTTGCTATGGTACGCAACGTCTGGCAG
CCCTTCCCCAATGGCACACGGCTTCCGGATGAGGAGAAGAACAGGCTGGGCCAGAGGCCATGGATGAACGCGTCG
CGCACCCGCTTCGTCGACGATGAGATCGAACCTGGTCCGTACAAAGAAATCCTGCCATGCGAGGACATATGCTAC
GAGGTGGTGCAGAGCTGCCCGGCCAATCTTCAGTTCACATGCCCGCAGCCAGGCATGTTGAGCTTCAATCACAGC
TATGGACAGCGAGACGTCAACGGGTCGACGGTTTCGTGCAACTACCCTGGTGAAGCGCGGACGCGCATGAGCGGC
GCCGCGGCACTGCTGCCAGACCTGATACGACTTGGCGCTATTTCCTTGTTCGCGACGGCTGTTCTGACGGTCAGG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail