Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5776
Gene name
LocationContig_291:12273..14055
Strand-
Gene length (bp)1782
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09286 Pro-kuma_activ Pro-kumamolisin, activation domain 1.0E-21 57 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 1 593 1.0E-98
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 22 593 3.0E-98
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 589 4.0E-96
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 28 589 9.0E-93
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 22 591 1.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 1 593 1.0E-98
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 22 593 3.0E-98
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 589 4.0E-96
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 28 589 9.0E-93
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 22 591 1.0E-91
sp|C5FBW2|SED2_ARTOC Tripeptidyl-peptidase SED2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED2 PE=3 SV=1 22 590 6.0E-89
sp|D4D9U2|SED4_TRIVH Probable tripeptidyl-peptidase SED4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED4 PE=3 SV=2 28 591 3.0E-87
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 28 591 1.0E-86
sp|D4D7N6|SED3_TRIVH Probable tripeptidyl-peptidase SED3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED3 PE=3 SV=2 22 590 2.0E-85
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 22 590 9.0E-85
sp|D4AK75|SED3_ARTBC Probable tripeptidyl-peptidase SED3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED3 PE=3 SV=2 22 590 2.0E-84
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 22 590 3.0E-84
sp|Q70DX9|SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed1 PE=1 SV=1 23 593 3.0E-51
sp|Q60HH1|TPP1_MACFA Tripeptidyl-peptidase 1 OS=Macaca fascicularis GN=TPP1 PE=2 SV=2 6 592 5.0E-49
sp|Q8NK92|AORSN_ASPOR Aorsin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aorO PE=1 SV=2 71 593 1.0E-46
sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus GN=Tpp1 PE=1 SV=2 6 592 3.0E-46
sp|O14773|TPP1_HUMAN Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2 6 592 3.0E-46
sp|Q5IS74|TPP1_PANTR Tripeptidyl-peptidase 1 OS=Pan troglodytes GN=TPP1 PE=2 SV=1 6 592 4.0E-46
sp|Q9EQV6|TPP1_RAT Tripeptidyl-peptidase 1 OS=Rattus norvegicus GN=Tpp1 PE=1 SV=1 27 592 7.0E-46
sp|Q9XSB8|TPP1_CANLF Tripeptidyl-peptidase 1 OS=Canis lupus familiaris GN=TPP1 PE=3 SV=1 6 592 1.0E-44
sp|Q0V8B6|TPP1_BOVIN Tripeptidyl-peptidase 1 OS=Bos taurus GN=TPP1 PE=2 SV=1 6 592 2.0E-44
sp|Q5RFL1|TPP1_PONAB Tripeptidyl-peptidase 1 OS=Pongo abelii GN=TPP1 PE=2 SV=1 6 592 1.0E-43
sp|C5FHK0|SED1_ARTOC Tripeptidyl-peptidase SED1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED1 PE=3 SV=1 4 593 6.0E-40
sp|Q55CT0|TPP1_DICDI Tripeptidyl-peptidase 1 OS=Dictyostelium discoideum GN=tpp1 PE=3 SV=1 68 592 3.0E-35
sp|Q8MZS4|PHYSA_PHYPO Physarolisin OS=Physarum polycephalum PE=1 SV=1 71 593 1.0E-30
sp|Q4WGU1|SED5_ASPFU Tripeptidyl-peptidase sed5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed5 PE=3 SV=2 322 579 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5776
MRSYLLLSAWALAQHGLCAVRLESAPVLPDGWEQLSEAPPAEAPYRLGVALRRPQTHDRLKRSIASQAHLSAADV
RALRKPPKKKVEGVRRWLADHGVTDVRRRHDWLDVGTSVGTAERLLGTKLHYYSYRGRRPVVRAKEYFVPDALAP
SISFVHPVTNFMSPMPRPAPFVWSGRGLGLALGKRRAGHGLDCAAAIVPECLFKLYNMSYATPDGKSPIRLGVAG
FLDQYANSADTHEFLRETVPAVARTGHTFAVELAHGGCNPQNRSLAGTEANLDVQYALALAHPAQVVFYSVGGQG
TRLDGSGVPYPQTEPPDPYAANEPWLDLVEHLLAKPDDQVPHVLSLSYADNEQSVPRAYAERVCHLFGLLTARGT
SVIGGSGDGGARGAQDDSDTCHTNDAARRPVTVPTFPSTCPWVTSVGSVTTYLPDPQGANFSTGGFSLIFGREPW
QDAAVEGYVRALDGHLSGYYNSSMRAIPDLAVAGTRFLSVVNGLAGVGSGTSYSTPVFASMIALVNDARVRRGKR
VLGWLNERLYSAPVRAVLRDITAGESLSCVFPGGAAPGGWPAKRGWDAITGLGAPADFDDLMRVLVDL*
Coding >Hirsu2|5776
ATGAGGTCATATCTGCTCCTGTCCGCCTGGGCGCTCGCCCAGCACGGCCTATGCGCCGTGCGCCTCGAGAGCGCC
CCCGTGCTCCCCGACGGATGGGAGCAGCTGAGCGAGGCGCCGCCGGCCGAGGCACCGTACCGGCTCGGCGTGGCC
CTTCGCCGGCCGCAGACGCACGACAGGCTCAAGCGCAGCATCGCGTCGCAGGCCCACCTCTCGGCCGCCGACGTC
AGGGCGCTCCGGAAGCCGCCGAAGAAGAAGGTCGAGGGCGTGCGGCGCTGGCTGGCCGACCACGGCGTCACGGAC
GTCAGGCGGCGGCACGACTGGCTCGACGTCGGCACCTCGGTCGGCACGGCCGAGAGGCTGCTGGGCACCAAGCTG
CACTACTATTCCTACCGCGGCCGGCGGCCGGTGGTGCGGGCCAAGGAGTATTTCGTCCCGGACGCGCTGGCCCCG
TCCATCAGCTTCGTCCACCCCGTCACCAACTTCATGAGTCCGATGCCGCGGCCGGCGCCCTTCGTCTGGTCCGGT
CGCGGGCTGGGGCTGGCACTCGGAAAGCGCCGGGCGGGACATGGACTCGACTGCGCCGCCGCCATCGTCCCCGAG
TGCCTCTTCAAGCTGTACAACATGTCGTACGCGACGCCGGACGGCAAGTCGCCCATCCGTCTTGGCGTCGCCGGC
TTCCTCGACCAGTACGCCAACTCGGCCGACACGCACGAGTTCCTGCGCGAGACGGTGCCGGCGGTGGCGAGGACG
GGGCATACCTTCGCCGTCGAGCTCGCCCACGGCGGCTGCAACCCGCAGAACCGGTCGCTGGCCGGCACCGAGGCC
AACCTGGACGTGCAGTACGCGCTGGCCCTGGCCCACCCGGCGCAGGTCGTCTTCTACTCCGTCGGCGGCCAGGGC
ACGCGCCTCGACGGGTCCGGCGTGCCGTATCCGCAGACGGAGCCGCCGGACCCGTACGCGGCCAACGAGCCGTGG
CTCGACCTCGTCGAACACCTCCTCGCCAAGCCCGACGACCAGGTCCCCCACGTCCTGTCGCTGTCGTACGCCGAC
AACGAGCAGTCCGTGCCGCGGGCCTACGCCGAGCGCGTCTGCCACCTATTCGGCCTCCTGACGGCGCGCGGCACG
TCCGTCATCGGCGGCTCCGGCGACGGCGGCGCCCGCGGCGCCCAGGACGATAGCGACACGTGCCACACCAACGAC
GCCGCGCGGAGGCCGGTCACGGTCCCGACCTTCCCCTCGACCTGCCCGTGGGTCACGTCCGTCGGCTCCGTCACG
ACGTACCTCCCGGACCCGCAGGGCGCCAACTTCAGCACCGGCGGCTTCTCCCTCATCTTCGGGCGTGAGCCGTGG
CAGGACGCGGCCGTCGAGGGCTACGTGCGGGCTCTGGACGGCCACCTGAGCGGCTACTACAACTCGAGCATGCGC
GCCATACCGGATCTCGCAGTGGCCGGCACGCGCTTCCTCTCCGTCGTCAACGGCTTGGCGGGCGTCGGCTCCGGG
ACCAGCTACAGCACGCCCGTCTTCGCCTCCATGATTGCGCTTGTCAACGACGCGCGCGTGCGCCGCGGCAAGCGC
GTGTTGGGCTGGCTGAACGAGCGGCTCTACTCCGCGCCGGTCCGCGCCGTGCTGCGCGACATCACCGCCGGCGAG
AGCCTCTCGTGCGTCTTTCCGGGTGGGGCCGCTCCGGGGGGGTGGCCGGCGAAGCGGGGCTGGGACGCCATCACC
GGCCTCGGCGCGCCGGCGGATTTCGACGACCTCATGCGCGTCCTCGTCGATTTGTGA
Transcript >Hirsu2|5776
ATGAGGTCATATCTGCTCCTGTCCGCCTGGGCGCTCGCCCAGCACGGCCTATGCGCCGTGCGCCTCGAGAGCGCC
CCCGTGCTCCCCGACGGATGGGAGCAGCTGAGCGAGGCGCCGCCGGCCGAGGCACCGTACCGGCTCGGCGTGGCC
CTTCGCCGGCCGCAGACGCACGACAGGCTCAAGCGCAGCATCGCGTCGCAGGCCCACCTCTCGGCCGCCGACGTC
AGGGCGCTCCGGAAGCCGCCGAAGAAGAAGGTCGAGGGCGTGCGGCGCTGGCTGGCCGACCACGGCGTCACGGAC
GTCAGGCGGCGGCACGACTGGCTCGACGTCGGCACCTCGGTCGGCACGGCCGAGAGGCTGCTGGGCACCAAGCTG
CACTACTATTCCTACCGCGGCCGGCGGCCGGTGGTGCGGGCCAAGGAGTATTTCGTCCCGGACGCGCTGGCCCCG
TCCATCAGCTTCGTCCACCCCGTCACCAACTTCATGAGTCCGATGCCGCGGCCGGCGCCCTTCGTCTGGTCCGGT
CGCGGGCTGGGGCTGGCACTCGGAAAGCGCCGGGCGGGACATGGACTCGACTGCGCCGCCGCCATCGTCCCCGAG
TGCCTCTTCAAGCTGTACAACATGTCGTACGCGACGCCGGACGGCAAGTCGCCCATCCGTCTTGGCGTCGCCGGC
TTCCTCGACCAGTACGCCAACTCGGCCGACACGCACGAGTTCCTGCGCGAGACGGTGCCGGCGGTGGCGAGGACG
GGGCATACCTTCGCCGTCGAGCTCGCCCACGGCGGCTGCAACCCGCAGAACCGGTCGCTGGCCGGCACCGAGGCC
AACCTGGACGTGCAGTACGCGCTGGCCCTGGCCCACCCGGCGCAGGTCGTCTTCTACTCCGTCGGCGGCCAGGGC
ACGCGCCTCGACGGGTCCGGCGTGCCGTATCCGCAGACGGAGCCGCCGGACCCGTACGCGGCCAACGAGCCGTGG
CTCGACCTCGTCGAACACCTCCTCGCCAAGCCCGACGACCAGGTCCCCCACGTCCTGTCGCTGTCGTACGCCGAC
AACGAGCAGTCCGTGCCGCGGGCCTACGCCGAGCGCGTCTGCCACCTATTCGGCCTCCTGACGGCGCGCGGCACG
TCCGTCATCGGCGGCTCCGGCGACGGCGGCGCCCGCGGCGCCCAGGACGATAGCGACACGTGCCACACCAACGAC
GCCGCGCGGAGGCCGGTCACGGTCCCGACCTTCCCCTCGACCTGCCCGTGGGTCACGTCCGTCGGCTCCGTCACG
ACGTACCTCCCGGACCCGCAGGGCGCCAACTTCAGCACCGGCGGCTTCTCCCTCATCTTCGGGCGTGAGCCGTGG
CAGGACGCGGCCGTCGAGGGCTACGTGCGGGCTCTGGACGGCCACCTGAGCGGCTACTACAACTCGAGCATGCGC
GCCATACCGGATCTCGCAGTGGCCGGCACGCGCTTCCTCTCCGTCGTCAACGGCTTGGCGGGCGTCGGCTCCGGG
ACCAGCTACAGCACGCCCGTCTTCGCCTCCATGATTGCGCTTGTCAACGACGCGCGCGTGCGCCGCGGCAAGCGC
GTGTTGGGCTGGCTGAACGAGCGGCTCTACTCCGCGCCGGTCCGCGCCGTGCTGCGCGACATCACCGCCGGCGAG
AGCCTCTCGTGCGTCTTTCCGGGTGGGGCCGCTCCGGGGGGGTGGCCGGCGAAGCGGGGCTGGGACGCCATCACC
GGCCTCGGCGCGCCGGCGGATTTCGACGACCTCATGCGCGTCCTCGTCGATTTGTGA
Gene >Hirsu2|5776
ATGAGGTCATATCTGCTCCTGTCCGCCTGGGCGCTCGCCCAGCACGGCCTATGCGCCGTGCGCCTCGAGAGCGCC
CCCGTGCTCCCCGACGGATGGGAGCAGCTGAGCGAGGCGCCGCCGGCCGAGGCACCGTACCGGCTCGGCGTGGCC
CTTCGCCGGCCGCAGACGCACGACAGGCTCAAGCGCAGCATCGCGTCGCAGGCCCACCTCTCGGCCGCCGACGTC
AGGGCGCTCCGGAAGCCGCCGAAGAAGAAGGTCGAGGGCGTGCGGCGCTGGCTGGCCGACCACGGCGTCACGGAC
GTCAGGCGGCGGCACGACTGGCTCGACGTCGGCACCTCGGTCGGCACGGCCGAGAGGCTGCTGGGCACCAAGCTG
CACTACTATTCCTACCGCGGCCGGCGGCCGGTGGTGCGGGCCAAGGAGTATTTCGTCCCGGACGCGCTGGCCCCG
TCCATCAGCTTCGTCCACCCCGTCACCAACTTCATGAGTCCGATGCCGCGGCCGGCGCCCTTCGTCTGGTCCGGT
CGCGGGCTGGGGCTGGCACTCGGAAAGCGCCGGGCGGGACATGGACTCGACTGCGCCGCCGCCATCGTCCCCGAG
TGCCTCTTCAAGCTGTACAACATGTCGTACGCGACGCCGGACGGCAAGTCGCCCATCCGTCTTGGCGTCGCCGGC
TTCCTCGACCAGTACGCCAACTCGGCCGACACGCACGAGTTCCTGCGCGAGACGGTGCCGGCGGTGGCGAGGACG
GGGCATACCTTCGCCGTCGAGCTCGCCCACGGCGGCTGCAACCCGCAGAACCGGTCGCTGGCCGGCACCGAGGCC
AACCTGGACGTGCAGTACGCGCTGGCCCTGGCCCACCCGGCGCAGGTCGTCTTCTACTCCGTCGGCGGCCAGGGC
ACGCGCCTCGACGGGTCCGGCGTGCCGTATCCGCAGACGGAGCCGCCGGACCCGTACGCGGCCAACGAGCCGTGG
CTCGACCTCGTCGAACACCTCCTCGCCAAGCCCGACGACCAGGTCCCCCACGTCCTGTCGCTGTCGTACGCCGAC
AACGAGCAGTCCGTGCCGCGGGCCTACGCCGAGCGCGTCTGCCACCTATTCGGCCTCCTGACGGCGCGCGGCACG
TCCGTCATCGGCGGCTCCGGCGACGGCGGCGCCCGCGGCGCCCAGGACGATAGCGACACGTGCCACACCAACGAC
GCCGCGCGGAGGCCGGTCACGGTCCCGACCTTCCCCTCGACCTGCCCGTGGGTCACGTCCGTCGGCTCCGTCACG
ACGTACCTCCCGGACCCGCAGGGCGCCAACTTCAGCACCGGCGGCTTCTCCCTCATCTTCGGGCGTGAGCCGTGG
CAGGACGCGGCCGTCGAGGGCTACGTGCGGGCTCTGGACGGCCACCTGAGCGGCTACTACAACTCGAGCATGCGC
GCCATACCGGATCTCGCAGTGGCCGGCACGCGCTTCCTCTCCGTCGTCAACGGCTTGGCGGGCGTCGGCTCCGGG
ACCAGCTACAGCACGCCCGTCTTCGCCTCCATGATTGCGCTTGTCAACGACGCGCGCGTGCGCCGCGGCAAGCGC
GTGTTGGGCTGGCTGAACGAGCGGCTCTACTCCGCGCCGGTCCGCGCCGTGCTGCGCGACATCACCGCCGGCGAG
AGCCTCTCGTGCGTCTTTCCGGGTGGGGCCGCTCCGGGGGGGTGGCCGGCGAAGCGGGGCTGGGACGCCATCACC
GGCCTCGGCGCGCCGGCGGATTTCGACGACCTCATGCGCGTCCTCGTCGATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail