Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|577
Gene name
LocationContig_1113:866..2697
Strand-
Gene length (bp)1831
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 7.3E-20 7 73
PF13516 LRR_6 Leucine Rich repeat 1.2E+00 314 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 1 501 3.0E-57
sp|Q5FVQ9|TBCE_RAT Tubulin-specific chaperone E OS=Rattus norvegicus GN=Tbce PE=2 SV=1 1 501 1.0E-56
sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens GN=TBCE PE=1 SV=1 7 547 5.0E-55
sp|Q5RBD9|TBCE_PONAB Tubulin-specific chaperone E OS=Pongo abelii GN=TBCE PE=2 SV=1 7 499 5.0E-55
sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus GN=TBCE PE=2 SV=1 2 499 6.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 1 501 3.0E-57
sp|Q5FVQ9|TBCE_RAT Tubulin-specific chaperone E OS=Rattus norvegicus GN=Tbce PE=2 SV=1 1 501 1.0E-56
sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens GN=TBCE PE=1 SV=1 7 547 5.0E-55
sp|Q5RBD9|TBCE_PONAB Tubulin-specific chaperone E OS=Pongo abelii GN=TBCE PE=2 SV=1 7 499 5.0E-55
sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus GN=TBCE PE=2 SV=1 2 499 6.0E-55
sp|Q5U508|TBCE_XENLA Tubulin-specific chaperone E OS=Xenopus laevis GN=tbce PE=2 SV=1 2 503 2.0E-53
sp|Q5U378|TBCE_DANRE Tubulin-specific chaperone E OS=Danio rerio GN=tbce PE=2 SV=2 7 497 2.0E-48
sp|Q8GRL7|TBCE_ARATH Tubulin-folding cofactor E OS=Arabidopsis thaliana GN=TFCE PE=2 SV=1 4 500 2.0E-38
sp|P39937|PAC2_YEAST Protein PAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC2 PE=1 SV=1 7 501 9.0E-31
sp|Q10303|ALP21_SCHPO Cell polarity protein alp21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp21 PE=1 SV=2 68 437 8.0E-24
sp|Q55CN0|TBCE_DICDI Tubulin-specific chaperone E OS=Dictyostelium discoideum GN=tbce PE=3 SV=1 6 353 1.0E-22
sp|Q5QJ74|TBCEL_HUMAN Tubulin-specific chaperone cofactor E-like protein OS=Homo sapiens GN=TBCEL PE=1 SV=2 80 400 3.0E-13
sp|Q5PQJ7|TBCEL_RAT Tubulin-specific chaperone cofactor E-like protein OS=Rattus norvegicus GN=Tbcel PE=1 SV=1 80 400 2.0E-12
sp|Q8C5W3|TBCEL_MOUSE Tubulin-specific chaperone cofactor E-like protein OS=Mus musculus GN=Tbcel PE=1 SV=1 80 400 9.0E-11
sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-3 PE=3 SV=3 7 72 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|577
MTPSPYVGQRISYGGAVCTVRYVGPVAGTTGSWLGIEWDDATRGKHDGSHKGVRYFSCLSRSPTAASFVRPTRPA
DKRLSFIAALREKYASEAPQLADGAPIVISGKVAEEMGFDKVRRKLARLDELRVVLLDGMRVASAVDEADGARVA
ETCPSIAQLDLSRNLLERLGPVLDICAELPALRHLSLNGNRFQHVADDTSLADDAAKAFGGVDELALGETLLGWE
ELCRIASLCPSLRTLAAGANQLSCLPAADYGGLATTLTSINLEYNDFKAVSDLAGLTSLRALRNLHLKGNAIAAM
AAPGAAAPTFPPALQYLDVSYNDIRDWAFVDALAAHFPGLTGLRIAHNPVYDGRDAGAEAAVVSWEESYMITIGR
LACLRSVNFTQVTAEDRKNAETFYLSRIAKQLAAVPESAEHGVLASHPRYRELCRIHGAPDVIRRSEVNPAFLEA
RLVAVRFRREGGPDRAARIPRALDIYSVRAIAGRLFGLSPLRLRLVWETDEWDPVAGYDERDADDDAPHRADGSP
GQPGRWLKREVELTHGPKQLGYCVDGMDVRIRVEPS*
Coding >Hirsu2|577
ATGACGCCATCCCCCTACGTCGGGCAGCGCATCTCCTACGGCGGCGCCGTCTGCACCGTCCGCTACGTCGGCCCC
GTCGCCGGCACGACGGGCTCCTGGCTCGGCATCGAGTGGGACGACGCGACGCGCGGGAAGCACGACGGATCCCAC
AAGGGCGTGCGCTACTTTTCCTGCCTTTCCCGGTCGCCGACGGCCGCCTCGTTCGTCCGCCCGACGCGGCCGGCG
GACAAGCGGCTGAGCTTCATCGCCGCGCTGCGGGAAAAGTACGCGTCCGAGGCGCCGCAGCTGGCGGATGGCGCG
CCCATCGTCATCTCCGGCAAGGTTGCCGAGGAGATGGGCTTCGACAAGGTGCGCCGCAAGCTGGCCCGGCTGGAC
GAGCTCCGGGTCGTCCTGCTGGACGGCATGCGCGTCGCGTCCGCCGTCGACGAGGCCGACGGCGCCCGCGTCGCC
GAGACGTGCCCCAGCATCGCCCAGCTCGACCTGAGCCGGAATCTGCTGGAGCGCCTCGGCCCGGTGCTGGACATC
TGCGCCGAGCTGCCGGCCCTGCGGCACCTCAGCCTCAATGGGAATCGGTTCCAGCATGTGGCGGACGATACGTCG
CTGGCCGATGATGCCGCGAAGGCCTTTGGCGGCGTCGACGAGCTCGCCCTCGGCGAGACCCTGCTCGGCTGGGAG
GAGCTGTGCCGGATCGCCTCCCTGTGCCCGTCGCTCCGGACGCTGGCCGCCGGGGCCAACCAGCTCTCGTGCCTG
CCGGCGGCCGACTACGGCGGGCTGGCGACGACGCTGACGTCCATCAACCTCGAGTACAACGACTTCAAGGCCGTC
TCGGACCTCGCCGGCCTCACCTCCCTGCGCGCCCTCCGAAACCTGCACCTCAAGGGCAACGCGATCGCGGCCATG
GCCGCCCCGGGCGCCGCGGCGCCGACCTTCCCGCCGGCGCTGCAATACCTCGACGTGTCCTACAACGACATCCGG
GACTGGGCCTTTGTGGACGCCCTCGCCGCGCACTTCCCGGGCCTCACCGGCCTGCGCATCGCCCACAACCCTGTC
TACGACGGACGGGACGCCGGGGCCGAGGCCGCCGTCGTCTCCTGGGAGGAATCGTACATGATCACCATCGGGCGC
CTGGCCTGCCTGCGGAGCGTCAACTTCACGCAGGTGACGGCCGAGGACCGCAAGAACGCCGAGACATTCTACCTG
TCGAGGATCGCCAAGCAGCTGGCGGCGGTGCCCGAGTCGGCCGAGCACGGCGTGCTCGCCTCGCACCCCCGCTAC
CGCGAGCTGTGCCGGATCCACGGCGCGCCGGACGTGATCCGGCGCAGCGAGGTCAACCCGGCCTTCCTCGAGGCG
CGGCTCGTCGCCGTCCGCTTCCGCCGCGAGGGCGGGCCCGACCGGGCCGCGCGCATCCCCAGGGCCTTGGACATC
TACTCGGTCCGCGCCATCGCCGGCCGGCTCTTCGGCCTGTCCCCGCTGCGGCTGCGGCTCGTCTGGGAGACGGAC
GAGTGGGACCCCGTCGCCGGCTACGACGAGCGCGACGCCGACGACGACGCGCCGCACCGGGCCGACGGCTCGCCC
GGCCAGCCGGGACGCTGGCTCAAGCGCGAGGTGGAGCTCACGCACGGGCCGAAGCAGCTCGGCTACTGCGTCGAC
GGCATGGACGTGCGGATCCGCGTGGAACCGAGCTGA
Transcript >Hirsu2|577
ATGACGCCATCCCCCTACGTCGGGCAGCGCATCTCCTACGGCGGCGCCGTCTGCACCGTCCGCTACGTCGGCCCC
GTCGCCGGCACGACGGGCTCCTGGCTCGGCATCGAGTGGGACGACGCGACGCGCGGGAAGCACGACGGATCCCAC
AAGGGCGTGCGCTACTTTTCCTGCCTTTCCCGGTCGCCGACGGCCGCCTCGTTCGTCCGCCCGACGCGGCCGGCG
GACAAGCGGCTGAGCTTCATCGCCGCGCTGCGGGAAAAGTACGCGTCCGAGGCGCCGCAGCTGGCGGATGGCGCG
CCCATCGTCATCTCCGGCAAGGTTGCCGAGGAGATGGGCTTCGACAAGGTGCGCCGCAAGCTGGCCCGGCTGGAC
GAGCTCCGGGTCGTCCTGCTGGACGGCATGCGCGTCGCGTCCGCCGTCGACGAGGCCGACGGCGCCCGCGTCGCC
GAGACGTGCCCCAGCATCGCCCAGCTCGACCTGAGCCGGAATCTGCTGGAGCGCCTCGGCCCGGTGCTGGACATC
TGCGCCGAGCTGCCGGCCCTGCGGCACCTCAGCCTCAATGGGAATCGGTTCCAGCATGTGGCGGACGATACGTCG
CTGGCCGATGATGCCGCGAAGGCCTTTGGCGGCGTCGACGAGCTCGCCCTCGGCGAGACCCTGCTCGGCTGGGAG
GAGCTGTGCCGGATCGCCTCCCTGTGCCCGTCGCTCCGGACGCTGGCCGCCGGGGCCAACCAGCTCTCGTGCCTG
CCGGCGGCCGACTACGGCGGGCTGGCGACGACGCTGACGTCCATCAACCTCGAGTACAACGACTTCAAGGCCGTC
TCGGACCTCGCCGGCCTCACCTCCCTGCGCGCCCTCCGAAACCTGCACCTCAAGGGCAACGCGATCGCGGCCATG
GCCGCCCCGGGCGCCGCGGCGCCGACCTTCCCGCCGGCGCTGCAATACCTCGACGTGTCCTACAACGACATCCGG
GACTGGGCCTTTGTGGACGCCCTCGCCGCGCACTTCCCGGGCCTCACCGGCCTGCGCATCGCCCACAACCCTGTC
TACGACGGACGGGACGCCGGGGCCGAGGCCGCCGTCGTCTCCTGGGAGGAATCGTACATGATCACCATCGGGCGC
CTGGCCTGCCTGCGGAGCGTCAACTTCACGCAGGTGACGGCCGAGGACCGCAAGAACGCCGAGACATTCTACCTG
TCGAGGATCGCCAAGCAGCTGGCGGCGGTGCCCGAGTCGGCCGAGCACGGCGTGCTCGCCTCGCACCCCCGCTAC
CGCGAGCTGTGCCGGATCCACGGCGCGCCGGACGTGATCCGGCGCAGCGAGGTCAACCCGGCCTTCCTCGAGGCG
CGGCTCGTCGCCGTCCGCTTCCGCCGCGAGGGCGGGCCCGACCGGGCCGCGCGCATCCCCAGGGCCTTGGACATC
TACTCGGTCCGCGCCATCGCCGGCCGGCTCTTCGGCCTGTCCCCGCTGCGGCTGCGGCTCGTCTGGGAGACGGAC
GAGTGGGACCCCGTCGCCGGCTACGACGAGCGCGACGCCGACGACGACGCGCCGCACCGGGCCGACGGCTCGCCC
GGCCAGCCGGGACGCTGGCTCAAGCGCGAGGTGGAGCTCACGCACGGGCCGAAGCAGCTCGGCTACTGCGTCGAC
GGCATGGACGTGCGGATCCGCGTGGAACCGAGCTGA
Gene >Hirsu2|577
ATGACGCCATCCCCCTACGTCGGGCAGCGCATCTCCTACGGCGGCGCCGTCTGCACCGTCCGCTACGTCGGCCCC
GTCGCCGGCACGACGGGCTCCTGGCTCGGCATCGAGTGGGACGACGCGACGCGCGGGAAGCACGACGGATCCCAC
AAGGGCGTGCGCTACTTTTCCTGTGCGTCGCCTTGCCGGCCTCCCCCTTCCCTGCCGCCCCCGTCCCGTTTTGCT
GAGCAGCGGCCGGCGCAGGCCTTTCCCGGTCGCCGACGGCCGCCTCGTTCGTCCGCCCGACGCGGCCGGCGGACA
AGCGGCTGAGCTTCATCGCCGCGCTGCGGGAAAAGTACGCGTCCGAGGCGCCGCAGCTGGCGGATGGCGCGCCCA
TCGTCATCTCCGGCAAGGTTGCCGAGGAGATGGGCTTCGACAAGGTGCGCCGCAAGCTGGCCCGGCTGGACGAGC
TCCGGGTCGTCCTGCTGGACGGCATGCGCGTCGCGTCCGCCGTCGACGAGGCCGACGGCGCCCGCGTCGCCGAGA
CGTGCCCCAGCATCGCCCAGCTCGACCTGAGCCGGAATCTGCTGGAGCGCCTCGGCCCGGTGCTGGACATCTGCG
CCGAGCTGCCGGCCCTGCGGCACCTCAGCCTCAAGTACGTGTCCGTCCTGCTGCCGCGCCCGCTCGTCCGGGCCT
CGCTGCACATGCTGACCGGGAAGAAAAAATCAGTGGGAATCGGTTCCAGCATGTGGCGGACGATACGTCGCTGGC
CGATGATGCCGCGAAGGCCTTTGGCGGCGTCGACGAGCTCGCCCTCGGCGAGACCCTGCTCGGCTGGGAGGAGCT
GTGCCGGATCGCCTCCCTGTGCCCGTCGCTCCGGACGCTGGCCGCCGGGGCCAACCAGCTCTCGTGCCTGCCGGC
GGCCGACTACGGCGGGCTGGCGACGACGCTGACGTCCATCAACCTCGAGTACAACGACTTCAAGGCCGTCTCGGA
CCTCGCCGGCCTCACCTCCCTGCGCGCCCTCCGAAACCTGCACCTCAAGGGCAACGCGATCGCGGCCATGGCCGC
CCCGGGCGCCGCGGCGCCGACCTTCCCGCCGGCGCTGCAATACCTCGACGTGTCCTACAACGACATCCGGGACTG
GGCCTTTGTGGACGCCCTCGCCGCGCACTTCCCGGGCCTCACCGGCCTGCGCATCGCCCACAACCCTGTCTACGA
CGGACGGGACGCCGGGGCCGAGGCCGCCGTCGTCTCCTGGGAGGAATCGTACATGATCACCATCGGGCGCCTGGC
CTGCCTGCGGAGCGTCAACTTCACGCAGGTGACGGCCGAGGACCGCAAGAACGCCGAGACATTCTACCTGTCGAG
GATCGCCAAGCAGCTGGCGGCGGTGCCCGAGTCGGCCGAGCACGGCGTGCTCGCCTCGCACCCCCGCTACCGCGA
GCTGTGCCGGATCCACGGCGCGCCGGACGTGATCCGGCGCAGCGAGGTCAACCCGGCCTTCCTCGAGGCGCGGCT
CGTCGCCGTCCGCTTCCGCCGCGAGGGCGGGCCCGACCGGGCCGCGCGCATCCCCAGGGCCTTGGACATCTACTC
GGTCCGCGCCATCGCCGGCCGGCTCTTCGGCCTGTCCCCGCTGCGGCTGCGGCTCGTCTGGGAGACGGACGAGTG
GGACCCCGTCGCCGGCTACGACGAGCGCGACGCCGACGACGACGCGCCGCACCGGGCCGACGGCTCGCCCGGCCA
GCCGGGACGCTGGCTCAAGCGCGAGGTGGAGCTCACGCACGGGCCGAAGCAGCTCGGCTACTGCGTCGACGGCAT
GGACGTGCGGATCCGCGTGGAACCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail