Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5752
Gene name
LocationContig_29:22761..24660
Strand+
Gene length (bp)1899
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 6.8E-07 88 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 10 61 5.0E-10
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 10 61 5.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 10 61 5.0E-10
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 10 61 5.0E-10
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 10 61 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 10 61 5.0E-10
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 10 61 5.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 10 61 5.0E-10
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 10 61 5.0E-10
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 10 61 6.0E-10
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 10 61 6.0E-10
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 10 61 6.0E-10
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 14 61 6.0E-10
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 6 91 6.0E-10
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 10 61 7.0E-10
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 14 61 1.0E-09
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 6 59 1.0E-09
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 79 2.0E-09
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 15 66 2.0E-09
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 11 62 3.0E-09
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 11 62 3.0E-09
sp|Q9HBE1|PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens GN=PATZ1 PE=1 SV=1 3 62 3.0E-09
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 11 62 4.0E-09
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 11 62 5.0E-09
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 3 62 5.0E-09
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 3 62 5.0E-09
sp|P56270|MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens GN=MAZ PE=1 SV=1 7 81 6.0E-09
sp|P56671|MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus GN=Maz PE=1 SV=1 7 81 6.0E-09
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 77 9.0E-09
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 11 61 1.0E-08
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 11 61 1.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 11 75 1.0E-08
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 11 61 1.0E-08
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 11 61 2.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 11 61 2.0E-08
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 11 61 2.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 11 61 2.0E-08
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 11 61 2.0E-08
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 11 83 2.0E-08
sp|P56670|MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus GN=MAZ PE=2 SV=1 7 62 2.0E-08
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 15 59 2.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 3.0E-08
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 94 3.0E-08
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 6 95 3.0E-08
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 6 95 3.0E-08
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 15 76 4.0E-08
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 3 61 4.0E-08
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 15 77 4.0E-08
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 6 95 4.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 5.0E-08
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 6 98 5.0E-08
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 6 95 5.0E-08
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 6 95 5.0E-08
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 6 95 5.0E-08
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 15 81 5.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 14 82 5.0E-08
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 6 98 6.0E-08
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 6 98 7.0E-08
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 6 95 7.0E-08
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 6 95 7.0E-08
sp|Q5ANC8|TRY4_CANAL Transcriptional regulator of yeast form adherence 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY4 PE=2 SV=1 15 82 9.0E-08
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 2 132 1.0E-07
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 6 95 1.0E-07
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 6 95 1.0E-07
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 6 95 1.0E-07
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 14 62 1.0E-07
sp|P12383|PDR1_YEAST Transcription factor PDR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR1 PE=1 SV=2 68 145 1.0E-07
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 12 78 1.0E-07
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 14 61 1.0E-07
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 14 61 1.0E-07
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 18 98 2.0E-07
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 18 98 2.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 2.0E-07
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 6 98 2.0E-07
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 14 61 2.0E-07
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 15 83 2.0E-07
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 5 62 2.0E-07
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 6 62 2.0E-07
sp|Q8NCN2|ZBT34_HUMAN Zinc finger and BTB domain-containing protein 34 OS=Homo sapiens GN=ZBTB34 PE=2 SV=4 15 61 2.0E-07
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 6 62 2.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 14 75 2.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 15 79 2.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 14 62 2.0E-07
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 18 98 3.0E-07
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 18 98 3.0E-07
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 18 98 3.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 15 101 3.0E-07
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 83 3.0E-07
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 3 95 3.0E-07
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 18 98 4.0E-07
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 18 98 4.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 4.0E-07
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 5 62 4.0E-07
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 15 62 4.0E-07
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 6 95 4.0E-07
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 6 95 4.0E-07
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 6 95 4.0E-07
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 18 107 5.0E-07
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 77 5.0E-07
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 9 78 5.0E-07
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 18 107 6.0E-07
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 18 107 6.0E-07
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 6.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 11 92 6.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 15 62 6.0E-07
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 7 95 6.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 7.0E-07
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 9 69 7.0E-07
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 15 69 7.0E-07
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 11 61 8.0E-07
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 15 75 8.0E-07
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 18 61 8.0E-07
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 75 8.0E-07
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 14 48 9.0E-07
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 62 9.0E-07
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 9.0E-07
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 16 98 1.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 1.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 14 61 1.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 14 75 1.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 11 75 1.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 15 92 1.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 62 1.0E-06
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 5 77 1.0E-06
sp|P53243|YG2A_YEAST Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR067C PE=3 SV=2 10 82 1.0E-06
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 3 72 1.0E-06
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 7 61 1.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 14 75 1.0E-06
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 14 61 1.0E-06
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 15 52 1.0E-06
sp|Q86UZ6|ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens GN=ZBTB46 PE=1 SV=2 15 53 1.0E-06
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 10 68 1.0E-06
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 18 98 2.0E-06
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 18 98 2.0E-06
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 18 98 2.0E-06
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 18 98 2.0E-06
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 18 98 2.0E-06
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 18 98 2.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 10 75 2.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 15 61 2.0E-06
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 75 2.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 8 72 2.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 14 86 2.0E-06
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 15 82 2.0E-06
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 18 61 2.0E-06
sp|Q8BID6|ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus GN=Zbtb46 PE=1 SV=2 15 53 2.0E-06
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 14 62 2.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 8 77 2.0E-06
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 15 83 2.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 75 2.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 92 2.0E-06
sp|O94392|YLV1_SCHPO Uncharacterized transcriptional regulatory protein C2H10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2H10.01 PE=3 SV=1 81 121 2.0E-06
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 2.0E-06
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 18 61 2.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 62 2.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 18 61 2.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 3.0E-06
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 9 75 3.0E-06
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 9 75 3.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 15 81 3.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 3.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 3.0E-06
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 15 68 3.0E-06
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 14 68 3.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 15 95 3.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 62 3.0E-06
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 14 68 3.0E-06
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 15 62 3.0E-06
sp|Q9WTY8|ZBT10_RAT Zinc finger and BTB domain-containing protein 10 OS=Rattus norvegicus GN=Zbtb10 PE=2 SV=1 14 50 3.0E-06
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 11 61 3.0E-06
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 10 64 3.0E-06
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 14 68 3.0E-06
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 6 62 3.0E-06
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 14 68 3.0E-06
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 14 68 3.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 8 75 3.0E-06
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 11 75 3.0E-06
sp|Q6YND2|ZN653_MOUSE Zinc finger protein 653 OS=Mus musculus GN=Znf653 PE=2 SV=2 15 80 3.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 61 3.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 77 3.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 11 75 3.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 18 61 3.0E-06
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 11 61 3.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 15 61 3.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 11 75 3.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 11 75 3.0E-06
sp|Q96CK0|ZN653_HUMAN Zinc finger protein 653 OS=Homo sapiens GN=ZNF653 PE=1 SV=1 15 80 3.0E-06
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 15 62 3.0E-06
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 11 61 3.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 14 86 3.0E-06
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 15 77 3.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 15 61 3.0E-06
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 15 61 3.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 11 92 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 81 3.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 10 98 3.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 15 61 3.0E-06
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 15 62 3.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 11 92 4.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 15 94 4.0E-06
sp|P57071|PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens GN=PRDM15 PE=2 SV=4 15 95 4.0E-06
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 15 61 4.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 10 98 4.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 11 75 4.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 10 98 4.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 79 4.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 14 92 4.0E-06
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 15 61 4.0E-06
sp|Q8TF39|ZN483_HUMAN Zinc finger protein 483 OS=Homo sapiens GN=ZNF483 PE=1 SV=3 14 80 4.0E-06
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 18 61 4.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 14 99 4.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 11 65 4.0E-06
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 18 61 4.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 99 4.0E-06
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 14 75 5.0E-06
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 14 75 5.0E-06
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 18 62 5.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 14 62 5.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 14 75 5.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 75 5.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 83 5.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 14 86 5.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 5 83 5.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 14 75 5.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 83 5.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 11 75 5.0E-06
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 15 61 5.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 75 5.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 75 6.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 15 94 6.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 94 6.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 15 94 6.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 75 6.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 75 6.0E-06
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 15 61 6.0E-06
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 10 61 6.0E-06
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 50 6.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 2 77 6.0E-06
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 7 60 6.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 9 82 6.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 15 75 6.0E-06
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 14 48 6.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 14 99 6.0E-06
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 11 75 6.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 7.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 14 61 7.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 94 7.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 75 7.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 3 61 7.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 14 94 7.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 14 77 7.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 14 72 7.0E-06
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 14 75 7.0E-06
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 15 65 7.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 75 7.0E-06
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 9 62 7.0E-06
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 15 65 7.0E-06
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 8 64 7.0E-06
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 15 61 7.0E-06
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 15 65 7.0E-06
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 15 65 7.0E-06
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 18 65 7.0E-06
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 4 62 7.0E-06
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 14 48 7.0E-06
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 15 62 7.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 15 61 7.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 14 62 7.0E-06
sp|Q9P0T4|ZN581_HUMAN Zinc finger protein 581 OS=Homo sapiens GN=ZNF581 PE=1 SV=1 3 95 7.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 77 8.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 62 8.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 61 8.0E-06
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 7 61 8.0E-06
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 14 75 8.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 14 62 8.0E-06
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 15 62 8.0E-06
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 14 48 8.0E-06
sp|Q9H0D2|ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens GN=ZNF541 PE=2 SV=3 15 78 8.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 14 82 8.0E-06
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 61 8.0E-06
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 14 62 8.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 10 101 8.0E-06
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 15 62 8.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 14 82 8.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 14 82 8.0E-06
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 59 8.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 14 82 8.0E-06
sp|Q8R2V3|ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus GN=Znf445 PE=2 SV=2 6 62 8.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 14 75 8.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 61 9.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 11 83 9.0E-06
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 75 9.0E-06
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 14 62 9.0E-06
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 15 62 9.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 14 61 9.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 15 75 9.0E-06
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 15 80 9.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 1 62 9.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 14 61 9.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 14 82 9.0E-06
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 14 64 9.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 62 9.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 15 71 1.0E-05
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 15 75 1.0E-05
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 75 1.0E-05
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 10 75 1.0E-05
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 75 1.0E-05
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 5 83 1.0E-05
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 14 75 1.0E-05
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 14 61 1.0E-05
sp|P18752|ZO72_XENLA Oocyte zinc finger protein XlCOF7.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 18 75 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5752
MPPGQPQRKRKDKKCNVCGRHFARSEHLNRHSLTHTKEKPFSCSICGRCFPRADVQNLHMRTCRNAYDFSASETG
LSRERPTRRVEVACDNCRRRKTRCCGGHPCSSCSIRRSTCHYSTLSTAAEGSRPPDRDNTVAAMTPYSQPAFDID
YSSGSYSEIGSPFAGQVSLASGLPPATSTPQYIPAADSALALAAGQASDTFDASSIQVVTPASLDTTLYGNYLPP
SPYELELNADGWDALSIVSTTASATDLSTSISTPGPPAGKALFEIMKEYFSRQSSIARTSGKIYPKPPHLLLYDT
VIINAFLNLFRRHLGPGFPLFRDAAPTQLNNPKLCLAMAAVGGLFSLAKGSYEMAKAMYNDSRRLALAAIHIGPE
LPTNADEALDEVKMFILIELYGILSGDGRSFSMVEIHHVDLRRQIRSGKEW*
Coding >Hirsu2|5752
ATGCCTCCGGGTCAGCCCCAGCGCAAGCGCAAGGACAAAAAGTGCAACGTCTGCGGCCGGCATTTTGCACGGTCG
GAGCACCTCAACAGACACAGCCTTACTCATACCAAGGAGAAGCCCTTCTCCTGCTCGATATGCGGCCGCTGCTTC
CCCCGCGCCGACGTCCAGAACCTTCACATGAGGACCTGTCGCAACGCCTACGACTTCTCCGCCTCCGAAACCGGC
CTGTCGAGGGAGCGGCCGACGCGGCGGGTCGAAGTCGCCTGCGACAACTGCCGTAGACGCAAGACTCGCTGCTGT
GGAGGCCACCCGTGCTCCTCCTGCAGCATCCGCCGTTCGACATGTCATTATTCCACTCTCTCCACCGCGGCCGAA
GGCTCACGACCGCCGGACCGAGACAATACTGTGGCCGCCATGACGCCCTACTCCCAGCCGGCCTTCGACATCGAC
TACAGCAGCGGCAGCTACTCCGAAATAGGCTCCCCCTTTGCCGGTCAGGTGTCCTTGGCCTCGGGACTTCCGCCC
GCGACGTCGACTCCTCAATATATTCCCGCCGCCGACTCTGCCCTCGCGTTGGCAGCCGGACAGGCTTCAGATACG
TTCGATGCGTCGTCGATACAAGTCGTCACCCCGGCCTCGCTCGACACGACCCTGTACGGCAACTACCTGCCGCCC
AGCCCCTACGAACTCGAACTCAACGCCGATGGCTGGGATGCACTCTCCATAGTCAGCACCACGGCCTCCGCCACC
GACCTGAGCACGTCAATCTCGACGCCTGGCCCGCCCGCCGGCAAGGCACTCTTCGAAATCATGAAGGAGTACTTC
AGCCGCCAGTCTAGCATCGCCAGGACGTCTGGAAAGATATACCCGAAGCCGCCTCATCTCCTGCTCTACGACACC
GTCATCATCAATGCATTCTTGAACCTGTTCCGCCGCCACCTGGGCCCCGGATTCCCCCTGTTCCGCGACGCCGCG
CCCACGCAGCTGAACAACCCGAAGCTCTGCCTGGCCATGGCTGCAGTCGGTGGACTATTCAGCCTGGCCAAGGGA
AGTTACGAGATGGCCAAAGCCATGTACAACGACTCAAGAAGACTGGCCCTGGCAGCGATTCACATCGGTCCCGAG
CTGCCTACCAACGCAGACGAGGCTCTGGACGAAGTCAAGATGTTCATCCTCATCGAGTTGTATGGCATTCTCAGC
GGCGATGGACGGAGCTTCTCGATGGTGGAGATCCACCATGTGGACTTGAGACGGCAAATACGTTCCGGCAAAGAG
TGGTGA
Transcript >Hirsu2|5752
ATGCCTCCGGGTCAGCCCCAGCGCAAGCGCAAGGACAAAAAGTGCAACGTCTGCGGCCGGCATTTTGCACGGTCG
GAGCACCTCAACAGACACAGCCTTACTCATACCAAGGAGAAGCCCTTCTCCTGCTCGATATGCGGCCGCTGCTTC
CCCCGCGCCGACGTCCAGAACCTTCACATGAGGACCTGTCGCAACGCCTACGACTTCTCCGCCTCCGAAACCGGC
CTGTCGAGGGAGCGGCCGACGCGGCGGGTCGAAGTCGCCTGCGACAACTGCCGTAGACGCAAGACTCGCTGCTGT
GGAGGCCACCCGTGCTCCTCCTGCAGCATCCGCCGTTCGACATGTCATTATTCCACTCTCTCCACCGCGGCCGAA
GGCTCACGACCGCCGGACCGAGACAATACTGTGGCCGCCATGACGCCCTACTCCCAGCCGGCCTTCGACATCGAC
TACAGCAGCGGCAGCTACTCCGAAATAGGCTCCCCCTTTGCCGGTCAGGTGTCCTTGGCCTCGGGACTTCCGCCC
GCGACGTCGACTCCTCAATATATTCCCGCCGCCGACTCTGCCCTCGCGTTGGCAGCCGGACAGGCTTCAGATACG
TTCGATGCGTCGTCGATACAAGTCGTCACCCCGGCCTCGCTCGACACGACCCTGTACGGCAACTACCTGCCGCCC
AGCCCCTACGAACTCGAACTCAACGCCGATGGCTGGGATGCACTCTCCATAGTCAGCACCACGGCCTCCGCCACC
GACCTGAGCACGTCAATCTCGACGCCTGGCCCGCCCGCCGGCAAGGCACTCTTCGAAATCATGAAGGAGTACTTC
AGCCGCCAGTCTAGCATCGCCAGGACGTCTGGAAAGATATACCCGAAGCCGCCTCATCTCCTGCTCTACGACACC
GTCATCATCAATGCATTCTTGAACCTGTTCCGCCGCCACCTGGGCCCCGGATTCCCCCTGTTCCGCGACGCCGCG
CCCACGCAGCTGAACAACCCGAAGCTCTGCCTGGCCATGGCTGCAGTCGGTGGACTATTCAGCCTGGCCAAGGGA
AGTTACGAGATGGCCAAAGCCATGTACAACGACTCAAGAAGACTGGCCCTGGCAGCGATTCACATCGGTCCCGAG
CTGCCTACCAACGCAGACGAGGCTCTGGACGAAGTCAAGATGTTCATCCTCATCGAGTTGTATGGCATTCTCAGC
GGCGATGGACGGAGCTTCTCGATGGTGGAGATCCACCATGTGGACTTGAGACGGCAAATACGTTCCGGCAAAGAG
TGGTGA
Gene >Hirsu2|5752
ATGCCTCCGGGTCAGCCCCAGCGCAAGCGCAAGGACAAAAAGGTCCGCCATCCCTCCCATGTCTCCTTCGTTTCC
TCCTCTCCCGCCGCAAGCTGGAATCCTGACGGCCTGTCTCGCAGTGCAACGTCTGCGGCCGGCATTTTGCACGGT
CGGAGCACCTCAACAGACACAGCCTTACTCGTGCGTAACTTGGCCGCCGCTGCTTTCCCCTGAGCTCCCCTTCCC
GTCCCGTCCCCGTCCCCTGCCCTGCCCTCAGAGAGAGTCCCCTCCCCCAGAGCGCCGTCCCGTTCGGTAGGCGGA
CCGAGGCTGAAGATGGCGAACCCCCGACCGCTTCAGATACCAAGGAGAAGCCCTTCTCCTGCTCGATATGCGGCC
GCTGCTTCCCCCGCGCCGACGTCCAGAACCTTCACATGAGGACCTGTCGCAACGCCTACGACTTCTCCGCCTCCG
AAACCGGCCTGTCGAGGGAGCGGCCGACGCGGCGGGTCGAAGTCGCCTGCGACAACTGCCGTAGACGCAAGACTC
GCTGCTGTGGAGGCCACCCGTGCTCCTCCTGCAGCATCCGCCGTTCGACATGTCATTATTCCACTCTCTCCACCG
CGGCCGAAGGCTCACGACCGCCGGACCGAGACAATACTGTGGCCGCCATGACGCCCTACTCCCAGCCGGCCTTCG
ACATCGACTACAGCAGCGGCAGCTACTCCGAAATAGGCTCCCCCTTTGCCGGTCAGGTGTCCTTGGCCTCGGGAC
TTCCGCCCGCGACGTCGACTCCTCAATATATTCCCGCCGCCGACTCTGCCCTCGCGTTGGCAGCCGGACAGGCTT
CAGATACGTTCGATGCGTCGTCGATACAAGTCGTCACCCCGGCCTCGCTCGACACGACCCTGTACGGCAACTACC
TGCCGCCCAGCCCCTACGAACTCGAACTCAACGCCGATGGCTGGGATGCACTCTCCATAGTAAGGCAGCAGCCGG
CACTGGCTCGGCCCTCCCAGAGATCCCTTGCTGACTCCCGCTCTTGCATCGCTCTAGAAACCCTCTTTCTGGGCG
CGAGAGACTGACCGGATCTCGTTGGCCGACCAGGTCAGCACCACGGCCTCCGCCACCGACCTGAGCACGTCAATC
TCGACGCCTGGCCCGCCCGCCGGCAAGGCACTCTTCGAAATCATGAAGGAGTACTTCAGCCGCCAGTCTAGCATC
GCCAGGACGTCTGGAAAGATATACCCGAAGCCGCCTCATCTCCTGCTCTACGACACCGTCATCATCAATGCATTC
TTGAACCTGTTCCGCCGCCACCTGGGCCCCGGATTCCCCCTGTTCCGCGACGCCGCGCCCACGCAGCTGAACAAC
CCGAAGCTCTGCCTGGCCATGGCTGCAGTCGGTGGACTATTCAGCCTGGCCAAGGGAAGTTACGAGATGGCCAAA
GCCATGTACAACGACTCAAGAAGACTGGCCCTGGCAGCGGTACGCTTTCTCACCCCCCTCTCCCCTGTTTCTTTT
TCATCCCCTTTTTCTCTTCTTTTTCATTTTACTCCAGCTCCCGCCGTCTTATCTAACGGTAGATGTATGTATGAC
CTGTGCAGATTCACATCGGTCCCGAGCTGCCTACCAACGCAGACGAGGCTCTGGACGAAGTCAAGATGGTACGTT
TCCGCCTTGACTCAGCAACGTGAGAGGCTGATTGTCAACGGTCTCGACCGTCGCCACAGTTCATCCTCATCGAGT
TGTATGGCATTCTCAGCGGCGATGGACGGAGCTTCTCGATGGTGGAGATCCACCATGTGGACTTGAGACGGGTAA
GTTTTGATTCCCTGTCTCACGAGTCGCGGCAAGCACGAGTTGACAGACCTGCAAGGCTCTCGAATGTTATAGCAA
ATACGTTCCGGCAAAGAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail