Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5749
Gene name
LocationContig_29:7907..8882
Strand-
Gene length (bp)975
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP Emopamil binding protein 1.2E-71 20 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0P0|EBPL_MOUSE Emopamil-binding protein-like OS=Mus musculus GN=Ebpl PE=2 SV=1 38 231 6.0E-31
sp|Q9BY08|EBPL_HUMAN Emopamil-binding protein-like OS=Homo sapiens GN=EBPL PE=1 SV=1 38 241 3.0E-28
sp|Q60490|EBP_CAVPO 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Cavia porcellus GN=EBP PE=1 SV=3 104 218 2.0E-12
sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens GN=EBP PE=1 SV=3 111 232 1.0E-11
sp|P70245|EBP_MOUSE 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Mus musculus GN=Ebp PE=1 SV=3 112 239 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0P0|EBPL_MOUSE Emopamil-binding protein-like OS=Mus musculus GN=Ebpl PE=2 SV=1 38 231 6.0E-31
sp|Q9BY08|EBPL_HUMAN Emopamil-binding protein-like OS=Homo sapiens GN=EBPL PE=1 SV=1 38 241 3.0E-28
sp|Q60490|EBP_CAVPO 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Cavia porcellus GN=EBP PE=1 SV=3 104 218 2.0E-12
sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens GN=EBP PE=1 SV=3 111 232 1.0E-11
sp|P70245|EBP_MOUSE 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Mus musculus GN=Ebp PE=1 SV=3 112 239 6.0E-11
sp|Q9FTZ2|EBP_ORYSJ Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Oryza sativa subsp. japonica GN=Os01g0103600 PE=2 SV=1 34 241 2.0E-10
sp|O48962|EBP_ARATH Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Arabidopsis thaliana GN=At1g20050 PE=2 SV=1 104 218 1.0E-09
sp|Q9JJ46|EBP_RAT 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Rattus norvegicus GN=Ebp PE=2 SV=3 116 239 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0047750 cholestenol delta-isomerase activity Yes
GO:0016021 integral component of membrane Yes
GO:0016125 sterol metabolic process Yes
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0008202 steroid metabolic process No
GO:0044425 membrane part No
GO:1901360 organic cyclic compound metabolic process No
GO:0003674 molecular_function No
GO:0016860 intramolecular oxidoreductase activity No
GO:0016863 intramolecular oxidoreductase activity, transposing C=C bonds No
GO:1901615 organic hydroxy compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 46 68 22
3 136 158 22
4 165 184 19
5 204 226 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5749
MASESSLPPDLFDRTTIASLLSTVAIVGAAHATSRRVLAPGTSRTLRFLFIWHLADALCHFILEGSFLYHCFFSY
LVPGQGAAANLVDLFPTPYNFLGHEDRRIYGPQAGGDNPFAQLWMVYARADKRWAGADLDVISLELLTVLFCGPL
ACYICYLIAQKNPKASIWMIVLATSELYGGFMTFCPEWLTGNINLDSSNFMYLWVYLVFFNMLWVFIPLYAIWYS
FNDISHAFAVRQSKKKV*
Coding >Hirsu2|5749
ATGGCGTCGGAATCGTCGCTCCCGCCCGACCTGTTCGACCGGACGACCATCGCGTCGCTGCTGTCGACGGTGGCG
ATTGTCGGCGCCGCCCACGCGACGTCGCGGCGCGTGCTGGCGCCCGGGACGTCGCGGACCCTGCGCTTCCTCTTC
ATCTGGCACCTGGCCGACGCGTTGTGCCACTTCATCCTCGAGGGCAGCTTCCTCTACCACTGCTTCTTTTCGTAC
CTGGTGCCCGGCCAGGGCGCCGCCGCCAACCTGGTCGACCTGTTCCCGACGCCCTACAACTTCCTGGGCCACGAG
GACCGGCGGATCTATGGCCCGCAGGCCGGCGGCGACAATCCCTTTGCCCAGCTGTGGATGGTGTATGCGCGTGCC
GACAAGCGATGGGCCGGGGCGGATCTGGATGTCATCAGCTTGGAGCTCCTCACCGTCCTATTCTGCGGCCCGCTG
GCCTGCTACATCTGCTACCTGATTGCTCAGAAGAATCCCAAGGCCAGCATCTGGATGATCGTGTTGGCCACAAGC
GAGCTGTACGGCGGGTTCATGACGTTTTGCCCCGAGTGGCTCACCGGCAACATCAACCTTGACAGCAGCAACTTC
ATGTACCTTTGGGTGTACCTCGTCTTCTTCAACATGCTTTGGGTGTTCATCCCGCTCTATGCCATATGGTACTCG
TTCAATGATATATCTCATGCCTTTGCCGTGCGGCAGTCGAAGAAAAAGGTGTAA
Transcript >Hirsu2|5749
ATGGCGTCGGAATCGTCGCTCCCGCCCGACCTGTTCGACCGGACGACCATCGCGTCGCTGCTGTCGACGGTGGCG
ATTGTCGGCGCCGCCCACGCGACGTCGCGGCGCGTGCTGGCGCCCGGGACGTCGCGGACCCTGCGCTTCCTCTTC
ATCTGGCACCTGGCCGACGCGTTGTGCCACTTCATCCTCGAGGGCAGCTTCCTCTACCACTGCTTCTTTTCGTAC
CTGGTGCCCGGCCAGGGCGCCGCCGCCAACCTGGTCGACCTGTTCCCGACGCCCTACAACTTCCTGGGCCACGAG
GACCGGCGGATCTATGGCCCGCAGGCCGGCGGCGACAATCCCTTTGCCCAGCTGTGGATGGTGTATGCGCGTGCC
GACAAGCGATGGGCCGGGGCGGATCTGGATGTCATCAGCTTGGAGCTCCTCACCGTCCTATTCTGCGGCCCGCTG
GCCTGCTACATCTGCTACCTGATTGCTCAGAAGAATCCCAAGGCCAGCATCTGGATGATCGTGTTGGCCACAAGC
GAGCTGTACGGCGGGTTCATGACGTTTTGCCCCGAGTGGCTCACCGGCAACATCAACCTTGACAGCAGCAACTTC
ATGTACCTTTGGGTGTACCTCGTCTTCTTCAACATGCTTTGGGTGTTCATCCCGCTCTATGCCATATGGTACTCG
TTCAATGATATATCTCATGCCTTTGCCGTGCGGCAGTCGAAGAAAAAGGTGTAA
Gene >Hirsu2|5749
ATGGCGTCGGAATCGTCGCTCCCGCCCGACCTGTTCGACCGGACGACCATCGCGTCGCTGCTGTCGACGGTGGCG
ATTGTCGGCGCCGCCCACGCGACGTCGCGGCGCGTGCTGGCGCCCGGGACGTCGCGGACCCTGCGCTTCCTCTTC
ATCTGGCACCTGGCCGACGCGTTGTGCCACTTCATCCTCGAGGGCAGCTTCCTCTACCACTGCTTCTTTTCGTAC
CTGGTGCCCGGCCAGGGCGCCGCCGCCAACCTGGTCGACCTGTTCCCGACGCCCTACAACTTCCTGGGCCACGAG
GACCGGCGGATCTATGGCCCGCAGGCCGGCGGCGACAATCCCTTTGCCCAGCTGTGGATGGTGTATGCGCGTGCC
GACAAGCGATGGGCCGGGGCGGATCTGGTACGAATAATCTCCTTCATCCGTGCTCCTCCCCCCTTCCAATCCGTA
CCTGTGTCAGAACCAGGAGAGATCGAATGAGGAGAGGGGGGGGCGGTGAAAACTGTGGTGGCTGACGCGTGGGCT
GCCTGGTCAGGATGTCATCAGCTTGGAGCTCCTCACCGTCCTATTCTGCGGCCCGCTGGCCTGCTACATCTGCTA
CCTGATTGCTCAGAAGAATCCCAAGGCCAGCATCTGGATGATCGTGTTGGCCACAAGCGAGCTGTACGGCGGTAC
GTGGTCGCCCCCTCTCGTTATCCAGATCCTCCCAACCCATCCGTCCTCGACGGATAAGCCACCCAGAGCGTAACG
CTCGACCATGAAATGACGAACCGCGCGCGTGTAGGGTTCATGACGTTTTGCCCCGAGTGGCTCACCGGCAACATC
AACCTTGACAGCAGCAACTTCATGTACCTTTGGGTGTACCTCGTCTTCTTCAACATGCTTTGGGTGTTCATCCCG
CTCTATGCCATATGGTACTCGTTCAATGATATATCTCATGCCTTTGCCGTGCGGCAGTCGAAGAAAAAGGTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail