Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5744
Gene name
LocationContig_2899:806..1571
Strand-
Gene length (bp)765
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01106 NifU NifU-like domain 4.7E-28 117 182
PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal 2.4E-18 3 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.19c PE=3 SV=1 1 208 7.0E-65
sp|Q9C8J2|NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana GN=NIFU5 PE=2 SV=1 2 191 2.0E-56
sp|B4NE93|NFU1_DROWI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila willistoni GN=GK25604 PE=3 SV=1 24 213 8.0E-56
sp|Q9LIG6|NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=NIFU4 PE=2 SV=1 2 191 2.0E-55
sp|B4PZ52|NFU1_DROYA NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila yakuba GN=GE15286 PE=3 SV=1 14 215 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.19c PE=3 SV=1 1 208 7.0E-65
sp|Q9C8J2|NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana GN=NIFU5 PE=2 SV=1 2 191 2.0E-56
sp|B4NE93|NFU1_DROWI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila willistoni GN=GK25604 PE=3 SV=1 24 213 8.0E-56
sp|Q9LIG6|NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=NIFU4 PE=2 SV=1 2 191 2.0E-55
sp|B4PZ52|NFU1_DROYA NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila yakuba GN=GE15286 PE=3 SV=1 14 215 3.0E-55
sp|B3NYF7|NFU1_DROER NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila erecta GN=GG17526 PE=3 SV=1 14 213 5.0E-54
sp|B4IMF6|NFU1_DROSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila sechellia GN=GM13534 PE=3 SV=1 14 215 5.0E-54
sp|B4M375|NFU1_DROVI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila virilis GN=GJ19011 PE=3 SV=1 26 212 6.0E-54
sp|Q8SY96|NFU1_DROME NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila melanogaster GN=CG32500 PE=2 SV=1 14 215 6.0E-54
sp|B4JWR9|NFU1_DROGR NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila grimshawi GN=GH17809 PE=3 SV=1 14 212 7.0E-54
sp|B4R3T1|NFU1_DROSI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila simulans GN=GD15490 PE=3 SV=1 14 215 2.0E-53
sp|B3MRT7|NFU1_DROAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila ananassae GN=GF20932 PE=3 SV=1 14 215 6.0E-53
sp|B4H303|NFU1_DROPE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila persimilis GN=GL13432 PE=3 SV=1 14 208 7.0E-53
sp|B5DKJ8|NFU1_DROPS NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22888 PE=3 SV=1 14 208 1.0E-52
sp|Q9QZ23|NFU1_MOUSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Mus musculus GN=Nfu1 PE=1 SV=2 2 190 9.0E-51
sp|Q9UMS0|NFU1_HUMAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Homo sapiens GN=NFU1 PE=1 SV=2 2 191 1.0E-50
sp|P32860|NFU1_YEAST NifU-like protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFU1 PE=1 SV=2 31 208 4.0E-46
sp|Q93W20|NIFU2_ARATH NifU-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=NIFU2 PE=1 SV=1 125 196 4.0E-12
sp|Q84LK7|NIFU1_ORYSJ NifU-like protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=NIFU1 PE=1 SV=1 115 196 1.0E-11
sp|Q00241|NIFU_LEPBY Nitrogen fixation protein NifU (Fragment) OS=Leptolyngbya boryana GN=nifU PE=3 SV=1 114 172 2.0E-10
sp|O32119|YUTI_BACSU Putative nitrogen fixation protein YutI OS=Bacillus subtilis (strain 168) GN=yutI PE=3 SV=1 117 173 3.0E-10
sp|Q84RQ7|NIFU3_ARATH NifU-like protein 3, chloroplastic OS=Arabidopsis thaliana GN=NIFU3 PE=2 SV=1 125 189 5.0E-10
sp|P33179|NIFU_ANASL Nitrogen fixation protein NifU (Fragment) OS=Anabaena sp. (strain L31) GN=nifU PE=3 SV=1 114 177 1.0E-09
sp|Q93W77|NIFU1_ARATH NifU-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=NIFU1 PE=1 SV=1 119 189 2.0E-09
sp|P20628|NIFU_NOSS1 Nitrogen fixation protein NifU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifU PE=3 SV=1 114 176 1.0E-08
sp|Q43885|NIFU_TRIAZ Nitrogen fixation protein NifU OS=Trichormus azollae GN=nifU PE=3 SV=1 114 176 2.0E-08
sp|P40432|YVN2_AZOVI Uncharacterized 10.3 kDa protein in vnfA 5'region OS=Azotobacter vinelandii PE=3 SV=1 99 164 4.0E-08
sp|C5BJC0|NFUA_TERTT Fe/S biogenesis protein NfuA OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=nfuA PE=3 SV=1 109 191 7.0E-08
sp|Q5QZC8|NFUA_IDILO Fe/S biogenesis protein NfuA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nfuA PE=3 SV=1 109 189 1.0E-07
sp|B7NMH9|NFUA_ECO7I Fe/S biogenesis protein NfuA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nfuA PE=3 SV=1 109 189 2.0E-07
sp|A8AQW7|NFUA_CITK8 Fe/S biogenesis protein NfuA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nfuA PE=3 SV=1 109 189 5.0E-07
sp|A1AGT8|NFUA_ECOK1 Fe/S biogenesis protein NfuA OS=Escherichia coli O1:K1 / APEC GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B1IP51|NFUA_ECOLC Fe/S biogenesis protein NfuA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|A8A5M2|NFUA_ECOHS Fe/S biogenesis protein NfuA OS=Escherichia coli O9:H4 (strain HS) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B1X760|NFUA_ECODH Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12 / DH10B) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|C4ZVW3|NFUA_ECOBW Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7M1X0|NFUA_ECO8A Fe/S biogenesis protein NfuA OS=Escherichia coli O8 (strain IAI1) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7N147|NFUA_ECO81 Fe/S biogenesis protein NfuA OS=Escherichia coli O81 (strain ED1a) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B5YTW5|NFUA_ECO5E Fe/S biogenesis protein NfuA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|P63022|NFUA_ECO57 Fe/S biogenesis protein NfuA OS=Escherichia coli O157:H7 GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7L4U4|NFUA_ECO55 Fe/S biogenesis protein NfuA OS=Escherichia coli (strain 55989 / EAEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7MDP0|NFUA_ECO45 Fe/S biogenesis protein NfuA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7UKB9|NFUA_ECO27 Fe/S biogenesis protein NfuA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|A7ZSU3|NFUA_ECO24 Fe/S biogenesis protein NfuA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q7N9W2|NFUA_PHOLL Fe/S biogenesis protein NfuA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|P63021|NFUA_ECOL6 Fe/S biogenesis protein NfuA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|P63020|NFUA_ECOLI Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12) GN=nfuA PE=1 SV=1 109 189 6.0E-07
sp|B7NE19|NFUA_ECOLU Fe/S biogenesis protein NfuA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B6I2X8|NFUA_ECOSE Fe/S biogenesis protein NfuA OS=Escherichia coli (strain SE11) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B1LHL4|NFUA_ECOSM Fe/S biogenesis protein NfuA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q1R5M0|NFUA_ECOUT Fe/S biogenesis protein NfuA OS=Escherichia coli (strain UTI89 / UPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B7LSB7|NFUA_ESCF3 Fe/S biogenesis protein NfuA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|B2U3M4|NFUA_SHIB3 Fe/S biogenesis protein NfuA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q31VL8|NFUA_SHIBS Fe/S biogenesis protein NfuA OS=Shigella boydii serotype 4 (strain Sb227) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q32AM7|NFUA_SHIDS Fe/S biogenesis protein NfuA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q0SZQ1|NFUA_SHIF8 Fe/S biogenesis protein NfuA OS=Shigella flexneri serotype 5b (strain 8401) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|P63023|NFUA_SHIFL Fe/S biogenesis protein NfuA OS=Shigella flexneri GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q3YWL1|NFUA_SHISS Fe/S biogenesis protein NfuA OS=Shigella sonnei (strain Ss046) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|Q0TC53|NFUA_ECOL5 Fe/S biogenesis protein NfuA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nfuA PE=3 SV=1 109 189 6.0E-07
sp|A7ME80|NFUA_CROS8 Fe/S biogenesis protein NfuA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nfuA PE=3 SV=1 109 189 7.0E-07
sp|A9MMB3|NFUA_SALAR Fe/S biogenesis protein NfuA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nfuA PE=3 SV=1 109 189 9.0E-07
sp|B4EZM8|NFUA_PROMH Fe/S biogenesis protein NfuA OS=Proteus mirabilis (strain HI4320) GN=nfuA PE=3 SV=1 109 189 1.0E-06
sp|A6TF37|NFUA_KLEP7 Fe/S biogenesis protein NfuA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nfuA PE=3 SV=1 109 189 1.0E-06
sp|B5XTS2|NFUA_KLEP3 Fe/S biogenesis protein NfuA OS=Klebsiella pneumoniae (strain 342) GN=nfuA PE=3 SV=1 109 189 1.0E-06
sp|B2VJW0|NFUA_ERWT9 Fe/S biogenesis protein NfuA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nfuA PE=3 SV=1 109 189 1.0E-06
sp|B5BHG9|NFUA_SALPK Fe/S biogenesis protein NfuA OS=Salmonella paratyphi A (strain AKU_12601) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|C4K405|NFUA_HAMD5 Fe/S biogenesis protein NfuA OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|Q8Z223|NFUA_SALTI Fe/S biogenesis protein NfuA OS=Salmonella typhi GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B4S1U9|NFUA_ALTMD Fe/S biogenesis protein NfuA OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=nfuA1 PE=3 SV=1 109 182 2.0E-06
sp|B5F8M8|NFUA_SALA4 Fe/S biogenesis protein NfuA OS=Salmonella agona (strain SL483) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|Q57IW3|NFUA_SALCH Fe/S biogenesis protein NfuA OS=Salmonella choleraesuis (strain SC-B67) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B5FKD2|NFUA_SALDC Fe/S biogenesis protein NfuA OS=Salmonella dublin (strain CT_02021853) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B5R371|NFUA_SALEP Fe/S biogenesis protein NfuA OS=Salmonella enteritidis PT4 (strain P125109) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B5R7K3|NFUA_SALG2 Fe/S biogenesis protein NfuA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B4TKT8|NFUA_SALHS Fe/S biogenesis protein NfuA OS=Salmonella heidelberg (strain SL476) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B4SVL5|NFUA_SALNS Fe/S biogenesis protein NfuA OS=Salmonella newport (strain SL254) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|A9MTT1|NFUA_SALPB Fe/S biogenesis protein NfuA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|C0Q0I7|NFUA_SALPC Fe/S biogenesis protein NfuA OS=Salmonella paratyphi C (strain RKS4594) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|B4TY71|NFUA_SALSV Fe/S biogenesis protein NfuA OS=Salmonella schwarzengrund (strain CVM19633) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|Q8ZLI7|NFUA_SALTY Fe/S biogenesis protein NfuA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|Q5PLY6|NFUA_SALPA Fe/S biogenesis protein NfuA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nfuA PE=3 SV=1 109 189 2.0E-06
sp|C5BGT5|NFUA_EDWI9 Fe/S biogenesis protein NfuA OS=Edwardsiella ictaluri (strain 93-146) GN=nfuA PE=3 SV=1 109 189 5.0E-06
sp|Q9I2P8|NFUA_PSEAE Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nfuA PE=3 SV=1 109 191 8.0E-06
sp|Q02KZ2|NFUA_PSEAB Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nfuA PE=3 SV=1 109 191 8.0E-06
sp|B7VB28|NFUA_PSEA8 Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain LESB58) GN=nfuA PE=3 SV=1 109 191 8.0E-06
sp|A6V6X0|NFUA_PSEA7 Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain PA7) GN=nfuA PE=3 SV=1 109 191 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0016226 iron-sulfur cluster assembly Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0031163 metallo-sulfur cluster assembly No
GO:0051540 metal cluster binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0006790 sulfur compound metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0048037 cofactor binding No
GO:0046914 transition metal ion binding No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0043167 ion binding No
GO:0051186 cofactor metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5744
LPNHRVVPATVGAPFIEYLNARSTISAPYPSPLAAKLMNIDGVVSVFYGADFITVTKAGDANWAHIRPEIFALIT
EAVASGEAMVHVAERRDAAGAAAEEEDSLAYREDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGFDDGYVKLKL
RGACRTCDSSTVTLKNGIEGMLMHYIEEVKGVHQILDQEEEIALQEFAKFEEKLKQQKAHQPASG*
Coding >Hirsu2|5744
CTGCCGAACCACCGGGTGGTGCCGGCGACGGTCGGGGCGCCGTTCATCGAGTACCTCAACGCGCGGTCGACGATT
TCGGCGCCGTACCCGTCGCCGCTGGCGGCGAAGCTGATGAACATCGACGGCGTCGTGTCCGTCTTCTACGGGGCC
GACTTCATCACCGTCACGAAGGCCGGCGACGCCAACTGGGCGCACATCCGGCCCGAGATCTTCGCGCTCATCACC
GAGGCCGTGGCGTCGGGCGAGGCCATGGTGCACGTGGCCGAGCGGCGGGACGCGGCCGGGGCGGCGGCCGAGGAG
GAGGACAGCCTGGCGTACCGCGAGGACGACGACGAGGTCGTCGGCATGATCAAGGAACTCCTCGAGACGCGCATC
CGGCCGGCCATCCAGGAGGACGGCGGCGACATCGAGTTCCGCGGCTTCGACGACGGCTACGTCAAGCTCAAGCTG
CGCGGGGCCTGCCGCACCTGCGACTCGAGCACCGTCACGCTCAAGAACGGCATCGAGGGCATGCTGATGCACTAC
ATCGAGGAGGTCAAGGGCGTGCACCAGATACTGGACCAGGAGGAGGAGATTGCGCTGCAGGAGTTCGCCAAGTTC
GAGGAGAAGCTGAAGCAGCAGAAGGCGCATCAGCCGGCATCGGGGTAG
Transcript >Hirsu2|5744
CTGCCGAACCACCGGGTGGTGCCGGCGACGGTCGGGGCGCCGTTCATCGAGTACCTCAACGCGCGGTCGACGATT
TCGGCGCCGTACCCGTCGCCGCTGGCGGCGAAGCTGATGAACATCGACGGCGTCGTGTCCGTCTTCTACGGGGCC
GACTTCATCACCGTCACGAAGGCCGGCGACGCCAACTGGGCGCACATCCGGCCCGAGATCTTCGCGCTCATCACC
GAGGCCGTGGCGTCGGGCGAGGCCATGGTGCACGTGGCCGAGCGGCGGGACGCGGCCGGGGCGGCGGCCGAGGAG
GAGGACAGCCTGGCGTACCGCGAGGACGACGACGAGGTCGTCGGCATGATCAAGGAACTCCTCGAGACGCGCATC
CGGCCGGCCATCCAGGAGGACGGCGGCGACATCGAGTTCCGCGGCTTCGACGACGGCTACGTCAAGCTCAAGCTG
CGCGGGGCCTGCCGCACCTGCGACTCGAGCACCGTCACGCTCAAGAACGGCATCGAGGGCATGCTGATGCACTAC
ATCGAGGAGGTCAAGGGCGTGCACCAGATACTGGACCAGGAGGAGGAGATTGCGCTGCAGGAGTTCGCCAAGTTC
GAGGAGAAGCTGAAGCAGCAGAAGGCGCATCAGCCGGCATCGGGGTAG
Gene >Hirsu2|5744
CTGCCGAACCACCGGGTGGTGCCGGCGACGGTCGGGGCGCCGTTCATCGAGTACCTCAACGCGCGGTCGACGATT
TCGGCGCCGTACCCGTCGCCGCTGGCGGCGAAGCTGATGAACATCGACGGCGTCGTGTCCGTCTTCTACGGGGCC
GACTTCATCACCGTCACGAAGGCCGGCGACGCCAACTGGGCGCACATCCGGCCCGAGATCTTCGCGCTCATCACC
GAGGCCGTGGCGTCGGGCGAGGCCATGGTGCACGTGGCCGAGCGGCGGGACGCGGCCGGGGCGGCGGCCGAGGAG
GAGGACAGCCTGGCGTACCGCGAGGACGACGACGAGGTCGTCGGCATGATCAAGGAACTCCTCGAGACGCGCATC
CGGCCGGCCATCCAGGAGGACGGCGGCGACATCGAGTTCCGCGGCTTCGACGACGGCTACGTCAAGCTCAAGCTG
CGCGGGGCCTGCCGCACCTGCGACTCGAGCACCGTCACGCTCAAGAACGGCATCGAGGGCATGCTGATGCACTAC
GTGAGTCGTCTCTCTTCCCCTCCCGTGTCCGCCCGCACCCGTTGTCTGCGTCCCTCTCTCTTTTTTTTTTGGGTT
GTTTTTCTCCCCCGTGCCAGCTTCTGACAGCTCGTCGCCCAGATCGAGGAGGTCAAGGGCGTGCACCAGATACTG
GACCAGGAGGAGGAGATTGCGCTGCAGGAGTTCGCCAAGTTCGAGGAGAAGCTGAAGCAGCAGAAGGCGCATCAG
CCGGCATCGGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail