Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5736
Gene name
LocationContig_289:15611..18661
Strand+
Gene length (bp)3050
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 8.4E-42 412 671
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 3.2E-29 97 349
PF14310 Fn3-like Fibronectin type III-like domain 9.4E-18 799 868

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 13 877 0.0E+00
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 32 877 0.0E+00
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 32 877 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 13 877 0.0E+00
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 32 877 0.0E+00
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 32 877 0.0E+00
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 4 877 0.0E+00
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 1 877 0.0E+00
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 32 877 0.0E+00
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 1 877 0.0E+00
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 28 877 0.0E+00
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 51 877 0.0E+00
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 11 807 0.0E+00
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 51 873 0.0E+00
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 51 873 0.0E+00
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 5 875 0.0E+00
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 51 871 0.0E+00
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 51 871 0.0E+00
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 51 878 0.0E+00
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 51 873 0.0E+00
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 34 871 0.0E+00
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 1 877 0.0E+00
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 35 871 0.0E+00
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 51 874 0.0E+00
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 35 871 0.0E+00
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 35 871 0.0E+00
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 35 871 0.0E+00
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 35 871 0.0E+00
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 6 871 0.0E+00
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 6 871 0.0E+00
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 51 680 0.0E+00
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 51 695 0.0E+00
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 51 677 0.0E+00
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 6 755 8.0E-170
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 51 682 7.0E-169
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 35 694 2.0E-152
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 35 694 3.0E-152
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 34 680 5.0E-150
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 35 682 2.0E-148
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 9 682 3.0E-148
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 35 694 1.0E-146
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 35 694 5.0E-146
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 31 680 7.0E-146
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 31 680 7.0E-146
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 35 684 2.0E-142
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 35 694 2.0E-142
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 6 681 3.0E-137
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 29 683 2.0E-134
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 6 681 3.0E-134
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 51 712 3.0E-108
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 51 701 1.0E-102
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 51 701 1.0E-102
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 230 693 1.0E-60
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 59 717 4.0E-60
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 57 678 5.0E-50
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 60 436 1.0E-47
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 52 684 2.0E-46
sp|F6C6C1|APY_BIFBA Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) GN=HMPREF9228_1477 PE=1 SV=1 52 684 2.0E-46
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 228 690 2.0E-45
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 32 436 8.0E-43
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 62 481 8.0E-43
sp|P29091|BGLS_SCHCO Beta-glucosidase (Fragment) OS=Schizophyllum commune PE=2 SV=1 467 649 2.0E-42
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 62 481 1.0E-40
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 62 481 3.0E-40
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 62 446 4.0E-40
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 62 446 4.0E-40
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 62 481 1.0E-39
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 62 481 2.0E-39
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 56 492 3.0E-39
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 56 492 3.0E-39
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 87 436 5.0E-39
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 62 436 7.0E-39
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 56 349 3.0E-38
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 62 489 4.0E-37
sp|Q94KD8|BXL2_ARATH Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1 6 684 4.0E-35
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 58 316 6.0E-35
sp|Q9LJN4|BXL5_ARATH Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2 57 675 1.0E-34
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 68 446 1.0E-34
sp|Q4WA69|BGLK_ASPFU Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglK PE=3 SV=1 53 446 1.0E-33
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 61 318 6.0E-33
sp|A5JTQ3|XYL2_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia GN=Xyl2 PE=2 SV=1 57 677 2.0E-32
sp|Q0CB82|BXLB_ASPTN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bxlB PE=3 SV=1 57 712 9.0E-31
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 87 368 4.0E-30
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 55 678 1.0E-29
sp|Q9FLG1|BXL4_ARATH Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1 57 678 2.0E-29
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 62 316 7.0E-29
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 62 316 1.0E-28
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 62 316 1.0E-28
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 69 365 1.0E-28
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 60 365 1.0E-28
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 60 365 2.0E-28
sp|Q9LXA8|BXL6_ARATH Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana GN=BXL6 PE=2 SV=1 6 680 2.0E-28
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 55 676 2.0E-27
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 55 689 4.0E-27
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 2 678 6.0E-27
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 2 678 7.0E-27
sp|Q5BAS1|XYND_EMENI Exo-1,4-beta-xylosidase xlnD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnD PE=1 SV=1 57 672 3.0E-26
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 56 677 9.0E-25
sp|B8MYV0|XYND_ASPFN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnD PE=3 SV=1 55 678 1.0E-24
sp|Q2UR38|XYND_ASPOR Exo-1,4-beta-xylosidase xlnD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnD PE=1 SV=1 55 678 2.0E-24
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 91 682 2.0E-24
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 57 678 2.0E-24
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 115 688 2.0E-24
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 51 211 8.0E-24
sp|Q9LXD6|BXL3_ARATH Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1 57 677 9.0E-24
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 115 720 3.0E-23
sp|A5JTQ2|XYL1_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia GN=Xyl1 PE=1 SV=1 57 677 3.0E-23
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 57 678 3.0E-23
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 57 678 3.0E-23
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 57 678 1.0E-22
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 57 678 7.0E-22
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 57 678 1.0E-21
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 59 310 2.0E-21
sp|B0YBJ3|BGLK_ASPFC Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglK PE=3 SV=1 53 446 2.0E-21
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 60 294 1.0E-20
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 758 877 3.0E-20
sp|O00089|XYND_ASPNG Exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger GN=xlnD PE=1 SV=2 55 688 2.0E-19
sp|A2QA27|XYND_ASPNC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnD PE=3 SV=1 55 688 2.0E-19
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 761 877 4.0E-19
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 761 877 5.0E-19
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 42 440 9.0E-19
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 757 874 1.0E-18
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 757 874 1.0E-18
sp|Q4AEG8|XYND_ASPAW Exo-1,4-beta-xylosidase xlnD OS=Aspergillus awamori GN=xlnD PE=2 SV=1 55 688 1.0E-18
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 761 877 2.0E-18
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 771 873 4.0E-18
sp|B6EY09|XYND_ASPJA Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus japonicus GN=xlnD PE=1 SV=1 55 684 5.0E-18
sp|P29090|BGL3_ASPWE Beta-glucosidase A-3 (Fragment) OS=Aspergillus wentii PE=1 SV=1 280 340 3.0E-17
sp|C0STH4|XYND_ASPAC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus aculeatus GN=xlnD PE=3 SV=1 55 684 5.0E-17
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 773 877 4.0E-16
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 772 871 1.0E-15
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 532 702 2.0E-15
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 771 877 3.0E-14
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 773 877 4.0E-14
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 532 702 4.0E-14
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 532 702 4.0E-14
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 773 877 5.0E-14
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 773 877 6.0E-14
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 771 873 9.0E-14
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 532 758 2.0E-13
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 774 873 7.0E-13
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 767 877 1.0E-12
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 532 684 1.0E-12
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 115 715 1.0E-12
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 532 684 3.0E-12
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 532 679 4.0E-12
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 532 702 5.0E-12
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 773 873 2.0E-11
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 773 878 2.0E-11
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 532 702 2.0E-11
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 532 728 2.0E-11
sp|P83344|XYNB_PRUPE Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1 525 678 2.0E-11
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 771 871 3.0E-11
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 771 871 3.0E-11
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 532 682 3.0E-11
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 532 682 3.0E-11
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 532 683 4.0E-11
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 771 871 5.0E-11
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 532 675 1.0E-10
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 532 697 1.0E-10
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 532 687 1.0E-10
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 56 433 1.0E-10
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 771 871 2.0E-10
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 532 728 6.0E-10
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 532 682 2.0E-09
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 397 712 9.0E-09
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 65 366 4.0E-08
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 532 706 5.0E-08
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 532 706 5.0E-08
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 773 877 2.0E-07
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 532 678 1.0E-06
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 532 678 1.0E-06
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 532 678 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1987 0.1347 0.7901 0.0964 0.1208 0.0175 0.2174 0.3722 0.1273 0.0045

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.998488

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 1.6E-56 90 311

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup338
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2687
Ophiocordyceps australis 1348a (Ghana) OphauG2|5011
Ophiocordyceps australis map64 (Brazil) OphauB2|3993
Ophiocordyceps australis map64 (Brazil) OphauB2|7961
Ophiocordyceps camponoti-floridani Ophcf2|06979
Ophiocordyceps camponoti-rufipedis Ophun1|7254
Ophiocordyceps kimflemingae Ophio5|7255
Ophiocordyceps subramaniannii Hirsu2|4268
Ophiocordyceps subramaniannii Hirsu2|5736 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5736
MRSQALVTTALLAAATAQGPAAYQSDGAAPQLAYSPPHYPSPWMDPKAPGWEESYKRARDFVSQLTLVEKVNLTT
GTGWMGDNCVGNTGAVPRMGLRALCMQDGPLGLRFNDYNSAFPVGITSGATWSRHLWRDRGKAMGAEAKVKGVDV
LLGPVSGPIGRAPTGGRNAEGFGPDPYLQGQALARTSEGIQGSGVIACAKHYIANEQEHFRQSGESKDQGFDISE
SLSSNIDDKTMHELYAWPFVDAVMAGVGSVMCSYNQINNSYGCQNSKLLNGILKAEMGFQGFVMSDWQAQHTGAA
SAVAGLDMTMPGDTVFNTGRSYWGGNLTLAVLNGTVPAWRLDDMATRIMAAFFKVGMTPGHQVDTSFNSWTRDSY
GYADQAAKENWQHINKQVNALSRDHAAHIRESAAKGTVVLKNTGVLPLHKPEFVAVVGEDAGPNPKGPNGCADRG
CDDGTLAMLWGSGTANFPYLVTPDSALQRQALEDGTRYESVLTNYAWDQARALVTQPNATAIVFANADAGEGFIT
VDGNIGDRKNLTLWKNGDDLIKNVSSVNPNTIVVIHSVGPVLVTDWYSNPNITAIVWAGQPGQESGNSLTDILYG
KTSPGRSPFTWGPTRESYGTDVLYKPNNGNGAPQDDFREGVFIDYRHFDKAAPGKPGDSGAPIYEFGYGLSWSTF
EYSDLDVRKEHVQPYQPTAGKTVAAPVLGNYSTDLKDYAFPPGIRYISQWIYPWLNTTTAGKEASADAQYGQKAE
QFLPPGATDGSPQHRLPSSGRPGGHEQLFDVLYTVSCTIKNTGRRTTDEVAQVYVGLGGEDEPVRVLRGFERLEG
IEPGRSVKFEAKLTRRDLSNWDTVSQNWVVTKHPKKVWVGSSSRNLPLHATLD*
Coding >Hirsu2|5736
ATGAGGTCGCAGGCCCTCGTCACCACGGCTTTGCTCGCTGCGGCCACGGCTCAAGGGCCAGCCGCTTATCAGTCG
GATGGCGCAGCCCCCCAACTTGCCTATTCGCCGCCACACTACCCGTCACCATGGATGGACCCCAAGGCTCCCGGC
TGGGAGGAGAGCTACAAGCGGGCCAGGGACTTCGTCTCCCAGCTGACCCTGGTCGAGAAGGTCAACCTCACCACA
GGCACCGGCTGGATGGGCGACAATTGTGTCGGAAACACGGGTGCCGTCCCTCGCATGGGTCTGCGTGCTCTCTGC
ATGCAGGACGGCCCTCTCGGCCTCCGTTTCAACGACTACAACAGCGCATTCCCCGTCGGCATCACTTCTGGCGCC
ACCTGGAGTAGGCATCTTTGGAGAGACCGTGGCAAGGCCATGGGGGCCGAAGCCAAGGTCAAGGGCGTCGACGTC
CTTCTCGGTCCCGTCTCGGGCCCCATTGGCCGAGCTCCGACCGGCGGCCGCAACGCCGAAGGCTTTGGCCCGGAT
CCCTATCTGCAGGGCCAAGCCCTGGCCCGCACCTCCGAGGGCATCCAGGGCAGCGGCGTCATTGCCTGTGCAAAG
CACTACATTGCCAACGAGCAGGAGCATTTCCGACAGTCTGGCGAGTCCAAAGACCAGGGCTTCGACATTTCCGAA
TCCCTATCCTCCAACATCGATGACAAGACGATGCACGAGCTGTATGCCTGGCCCTTCGTCGACGCTGTCATGGCC
GGCGTCGGCTCCGTCATGTGCTCGTACAACCAGATCAACAACTCGTACGGCTGCCAGAACTCCAAGCTCCTCAAC
GGCATCCTCAAAGCCGAGATGGGCTTCCAGGGCTTCGTCATGAGCGACTGGCAGGCACAGCACACGGGCGCCGCC
TCCGCCGTCGCCGGACTCGACATGACCATGCCGGGCGACACCGTCTTCAACACGGGCCGCAGCTACTGGGGCGGC
AACCTGACGCTGGCCGTTCTCAACGGCACCGTGCCCGCCTGGCGCCTCGACGACATGGCCACGCGCATCATGGCC
GCCTTCTTCAAGGTGGGCATGACCCCCGGCCATCAGGTCGACACCAGCTTCAATTCCTGGACGCGCGATTCCTAC
GGCTATGCCGACCAGGCCGCCAAGGAGAATTGGCAGCACATCAATAAGCAGGTCAATGCCCTCTCCCGCGACCAT
GCCGCCCACATCCGCGAGTCCGCCGCCAAAGGCACCGTCGTCCTGAAGAACACGGGCGTCCTGCCCTTGCACAAG
CCCGAGTTCGTCGCCGTTGTCGGCGAGGATGCCGGCCCCAACCCCAAGGGCCCCAACGGCTGCGCCGACCGCGGC
TGCGACGACGGCACCCTCGCCATGCTCTGGGGCTCCGGCACTGCCAACTTCCCCTACCTCGTCACTCCCGATAGC
GCCCTCCAGCGCCAGGCCCTCGAGGACGGCACTCGCTACGAGAGCGTCCTCACCAACTACGCCTGGGATCAAGCC
AGGGCTCTCGTGACCCAGCCCAACGCAACGGCCATCGTCTTCGCCAACGCCGACGCCGGCGAGGGCTTCATCACC
GTTGACGGCAACATCGGCGATCGCAAGAACCTCACCCTCTGGAAGAACGGCGACGACCTGATCAAGAACGTCTCC
TCCGTCAACCCCAACACCATCGTCGTCATCCACAGCGTCGGCCCCGTCTTGGTCACGGATTGGTACAGCAACCCC
AACATCACGGCCATTGTCTGGGCCGGCCAGCCGGGCCAGGAATCGGGCAACTCCCTGACCGATATCCTGTACGGC
AAGACGAGCCCCGGACGCTCGCCCTTCACTTGGGGGCCGACCCGGGAGAGCTACGGAACCGATGTCTTGTACAAG
CCCAACAACGGAAATGGTGCGCCTCAGGACGACTTCCGCGAAGGCGTCTTCATCGACTATCGCCACTTCGACAAG
GCGGCCCCCGGGAAGCCGGGCGACTCGGGCGCCCCCATCTACGAGTTCGGCTACGGCTTGTCTTGGTCGACGTTC
GAATACTCTGACCTGGACGTCCGCAAGGAACACGTCCAGCCGTACCAGCCGACCGCAGGCAAGACTGTGGCCGCT
CCCGTGCTAGGAAACTACAGTACCGACCTCAAGGATTATGCGTTCCCTCCGGGCATCCGGTACATCTCCCAGTGG
ATCTACCCTTGGCTCAACACGACGACTGCCGGCAAGGAAGCTTCGGCCGACGCTCAGTACGGCCAAAAGGCTGAG
CAATTCCTGCCGCCAGGCGCCACCGACGGCTCCCCTCAACACAGACTGCCCTCGTCTGGCAGACCTGGCGGCCAC
GAGCAGCTCTTTGACGTCTTGTATACGGTCTCGTGCACCATCAAGAACACCGGCCGTCGGACAACGGACGAAGTC
GCTCAAGTCTACGTCGGCCTCGGCGGTGAAGACGAGCCCGTGCGCGTGCTTCGAGGGTTCGAGCGACTCGAGGGG
ATCGAGCCCGGCCGGAGCGTCAAATTCGAAGCCAAGCTGACTCGACGGGACCTGAGCAACTGGGACACCGTCTCT
CAGAATTGGGTCGTGACGAAGCACCCCAAAAAGGTCTGGGTCGGCAGCAGCTCGCGCAACCTGCCTCTCCATGCG
ACGCTGGACTAG
Transcript >Hirsu2|5736
ATGAGGTCGCAGGCCCTCGTCACCACGGCTTTGCTCGCTGCGGCCACGGCTCAAGGGCCAGCCGCTTATCAGTCG
GATGGCGCAGCCCCCCAACTTGCCTATTCGCCGCCACACTACCCGTCACCATGGATGGACCCCAAGGCTCCCGGC
TGGGAGGAGAGCTACAAGCGGGCCAGGGACTTCGTCTCCCAGCTGACCCTGGTCGAGAAGGTCAACCTCACCACA
GGCACCGGCTGGATGGGCGACAATTGTGTCGGAAACACGGGTGCCGTCCCTCGCATGGGTCTGCGTGCTCTCTGC
ATGCAGGACGGCCCTCTCGGCCTCCGTTTCAACGACTACAACAGCGCATTCCCCGTCGGCATCACTTCTGGCGCC
ACCTGGAGTAGGCATCTTTGGAGAGACCGTGGCAAGGCCATGGGGGCCGAAGCCAAGGTCAAGGGCGTCGACGTC
CTTCTCGGTCCCGTCTCGGGCCCCATTGGCCGAGCTCCGACCGGCGGCCGCAACGCCGAAGGCTTTGGCCCGGAT
CCCTATCTGCAGGGCCAAGCCCTGGCCCGCACCTCCGAGGGCATCCAGGGCAGCGGCGTCATTGCCTGTGCAAAG
CACTACATTGCCAACGAGCAGGAGCATTTCCGACAGTCTGGCGAGTCCAAAGACCAGGGCTTCGACATTTCCGAA
TCCCTATCCTCCAACATCGATGACAAGACGATGCACGAGCTGTATGCCTGGCCCTTCGTCGACGCTGTCATGGCC
GGCGTCGGCTCCGTCATGTGCTCGTACAACCAGATCAACAACTCGTACGGCTGCCAGAACTCCAAGCTCCTCAAC
GGCATCCTCAAAGCCGAGATGGGCTTCCAGGGCTTCGTCATGAGCGACTGGCAGGCACAGCACACGGGCGCCGCC
TCCGCCGTCGCCGGACTCGACATGACCATGCCGGGCGACACCGTCTTCAACACGGGCCGCAGCTACTGGGGCGGC
AACCTGACGCTGGCCGTTCTCAACGGCACCGTGCCCGCCTGGCGCCTCGACGACATGGCCACGCGCATCATGGCC
GCCTTCTTCAAGGTGGGCATGACCCCCGGCCATCAGGTCGACACCAGCTTCAATTCCTGGACGCGCGATTCCTAC
GGCTATGCCGACCAGGCCGCCAAGGAGAATTGGCAGCACATCAATAAGCAGGTCAATGCCCTCTCCCGCGACCAT
GCCGCCCACATCCGCGAGTCCGCCGCCAAAGGCACCGTCGTCCTGAAGAACACGGGCGTCCTGCCCTTGCACAAG
CCCGAGTTCGTCGCCGTTGTCGGCGAGGATGCCGGCCCCAACCCCAAGGGCCCCAACGGCTGCGCCGACCGCGGC
TGCGACGACGGCACCCTCGCCATGCTCTGGGGCTCCGGCACTGCCAACTTCCCCTACCTCGTCACTCCCGATAGC
GCCCTCCAGCGCCAGGCCCTCGAGGACGGCACTCGCTACGAGAGCGTCCTCACCAACTACGCCTGGGATCAAGCC
AGGGCTCTCGTGACCCAGCCCAACGCAACGGCCATCGTCTTCGCCAACGCCGACGCCGGCGAGGGCTTCATCACC
GTTGACGGCAACATCGGCGATCGCAAGAACCTCACCCTCTGGAAGAACGGCGACGACCTGATCAAGAACGTCTCC
TCCGTCAACCCCAACACCATCGTCGTCATCCACAGCGTCGGCCCCGTCTTGGTCACGGATTGGTACAGCAACCCC
AACATCACGGCCATTGTCTGGGCCGGCCAGCCGGGCCAGGAATCGGGCAACTCCCTGACCGATATCCTGTACGGC
AAGACGAGCCCCGGACGCTCGCCCTTCACTTGGGGGCCGACCCGGGAGAGCTACGGAACCGATGTCTTGTACAAG
CCCAACAACGGAAATGGTGCGCCTCAGGACGACTTCCGCGAAGGCGTCTTCATCGACTATCGCCACTTCGACAAG
GCGGCCCCCGGGAAGCCGGGCGACTCGGGCGCCCCCATCTACGAGTTCGGCTACGGCTTGTCTTGGTCGACGTTC
GAATACTCTGACCTGGACGTCCGCAAGGAACACGTCCAGCCGTACCAGCCGACCGCAGGCAAGACTGTGGCCGCT
CCCGTGCTAGGAAACTACAGTACCGACCTCAAGGATTATGCGTTCCCTCCGGGCATCCGGTACATCTCCCAGTGG
ATCTACCCTTGGCTCAACACGACGACTGCCGGCAAGGAAGCTTCGGCCGACGCTCAGTACGGCCAAAAGGCTGAG
CAATTCCTGCCGCCAGGCGCCACCGACGGCTCCCCTCAACACAGACTGCCCTCGTCTGGCAGACCTGGCGGCCAC
GAGCAGCTCTTTGACGTCTTGTATACGGTCTCGTGCACCATCAAGAACACCGGCCGTCGGACAACGGACGAAGTC
GCTCAAGTCTACGTCGGCCTCGGCGGTGAAGACGAGCCCGTGCGCGTGCTTCGAGGGTTCGAGCGACTCGAGGGG
ATCGAGCCCGGCCGGAGCGTCAAATTCGAAGCCAAGCTGACTCGACGGGACCTGAGCAACTGGGACACCGTCTCT
CAGAATTGGGTCGTGACGAAGCACCCCAAAAAGGTCTGGGTCGGCAGCAGCTCGCGCAACCTGCCTCTCCATGCG
ACGCTGGACTAG
Gene >Hirsu2|5736
ATGAGGTCGCAGGCCCTCGTCACCACGGCTTTGCTCGCTGCGGCCACGGCTCAAGGGCCAGCCGCTTATCAGGTA
CGTCCATGCGACAGATCATCATCACCCGTCCGTCTCCGTCCAGATCCCCTTCTTATTTGCCCCCTCCTTTTCCCT
TTTCGGCTGCTTGGTCTTCGGCATCCAATGCCATCTTGTCTCGCCTCGTCCCACCAACGTCTGGTCCAACCCGGT
CATCCTCATTGATTGCCCCCTAACCATTCGTCTGCTCGCGCCTGGCCTCAATGCCTCTCACCCTGCCTCATCTCC
CCGGCGCAGCTGTCGCCGCTCTGGCTGTCCTTGCAAACGCTAATGTCCAGATTCCTCTGCAGTCGGATGGCGCAG
CCCCCCAACTTGCCTATTCGCCGCCACACTACCCGTCACCATGGATGGACCCCAAGGCTCCCGGCTGGGAGGAGA
GCTACAAGCGGGCCAGGGACTTCGTCTCCCAGCTGACCCTGGTCGAGAAGGTCAACCTCACCACAGGCACCGGGT
GAGTCCGTTGACGCCGGCCCTCCAAGCCGCCGCTCTCACCACTAACCGGCCTCCAGCTGGATGGGCGACAATTGT
GTCGGAAACACGGGTGCCGTCCCTCGCATGGGTCTGCGTGCTCTCTGCATGCAGGACGGCCCTCTCGGCCTCCGT
TTCAACGACTACAACAGCGCATTCCCCGTCGGCATCACTTCTGGCGCCACCTGGAGTAGGCATCTTTGGAGAGAC
CGTGGCAAGGCCATGGGGGCCGAAGCCAAGGTCAAGGGCGTCGACGTCCTTCTCGGTCCCGTCTCGGGCCCCATT
GGCCGAGCTCCGACCGGCGGCCGCAACGCCGAAGGCTTTGGCCCGGATCCCTATCTGCAGGGCCAAGCCCTGGCC
CGCACCTCCGAGGGCATCCAGGGCAGCGGCGTCATTGCCTGTGCAAAGCACTACATTGCCAACGAGCAGGGTAGG
CCTTCTCTTGGAGCCTTGTCCGGCATGAACTGGCCTCCTTCTGACGTGCGCCTCTTGCAGAGCATTTCCGACAGT
CTGGCGAGTCCAAAGACCAGGGCTTCGACATTTCCGAATCCCTATCCTCCAACATCGATGACAAGACGATGCACG
AGCTGTATGCCTGGCCCTTCGTCGACGCTGTCATGGCCGGCGTCGGCTCCGTCATGTGCTCGTACAACCAGATCA
ACAACTCGTACGGCTGCCAGAACTCCAAGCTCCTCAACGGCATCCTCAAAGCCGAGATGGGCTTCCAGGGCTTCG
TCATGAGCGACTGGCAGGCACAGCACACGGGCGCCGCCTCCGCCGTCGCCGGACTCGACATGACCATGCCGGGCG
ACACCGTCTTCAACACGGGCCGCAGCTACTGGGGCGGCAACCTGACGCTGGCCGTTCTCAACGGCACCGTGCCCG
CCTGGCGCCTCGACGACATGGCCACGCGCATCATGGCCGCCTTCTTCAAGGTGGGCATGACCCCCGGCCATCAGG
TCGACACCAGCTTCAATTCCTGGACGCGCGATTCCTACGGCTATGCCGACCAGGCCGCCAAGGAGAATTGGCAGC
ACATCAATAAGCAGGTCAATGCCCTCTCCCGCGACCATGCCGCCCACATCCGCGAGTCCGCCGCCAAAGGCACCG
TCGTCCTGAAGAACACGGGCGTCCTGCCCTTGCACAAGCCCGAGTTCGTCGCCGTTGTCGGCGAGGATGCCGGCC
CCAACCCCAAGGGCCCCAACGGCTGCGCCGACCGCGGCTGCGACGACGGCACCCTCGCCATGCTCTGGGGCTCCG
GCACTGCCAACTTCCCCTACCTCGTCACTCCCGATAGCGCCCTCCAGCGCCAGGCCCTCGAGGACGGCACTCGCT
ACGAGAGCGTCCTCACCAACTACGCCTGGGATCAAGCCAGGGCTCTCGTGACCCAGCCCAACGCAACGGCCATCG
TCTTCGCCAACGCCGACGCCGGCGAGGGCTTCATCACCGTTGACGGCAACATCGGCGATCGCAAGAACCTCACCC
TCTGGAAGAACGGCGACGACCTGATCAAGAACGTCTCCTCCGTCAACCCCAACACCATCGTCGTCATCCACAGCG
TCGGCCCCGTCTTGGTCACGGATTGGTACAGCAACCCCAACATCACGGCCATTGTCTGGGCCGGCCAGCCGGGCC
AGGAATCGGGCAACTCCCTGACCGATATCCTGTACGGCAAGACGAGCCCCGGACGCTCGCCCTTCACTTGGGGGC
CGACCCGGGAGAGCTACGGAACCGATGTCTTGTACAAGCCCAACAACGGAAATGGTGCGCCTCAGGACGACTTCC
GCGAAGGCGTCTTCATCGACTATCGCCACTTCGACAAGGCGGCCCCCGGGAAGCCGGGCGACTCGGGCGCCCCCA
TCTACGAGTTCGGCTACGGCTTGTCTTGGTCGACGTTCGAATACTCTGACCTGGACGTCCGCAAGGAACACGTCC
AGCCGTACCAGCCGACCGCAGGCAAGACTGTGGCCGCTCCCGTGCTAGGAAACTACAGTACCGACCTCAAGGATT
ATGCGTTCCCTCCGGGCATCCGGTACATCTCCCAGTGGATCTACCCTTGGCTCAACACGACGACTGCCGGCAAGG
AAGCTTCGGCCGACGCTCAGTACGGCCAAAAGGCTGAGCAATTCCTGCCGCCAGGCGCCACCGACGGCTCCCCTC
AACACAGACTGCCCTCGTCTGGCAGACCTGGCGGCCACGAGCAGCTCTTTGACGTCTTGTATACGGTCTCGTGCA
CCATCAAGAACACCGGCCGTCGGACAACGGACGAAGTCGCTCAAGTCTACGTCGGCCTCGGCGGTGAAGACGAGC
CCGTGCGCGTGCTTCGAGGGTTCGAGCGACTCGAGGGGATCGAGCCCGGCCGGAGCGTCAAATTCGAAGCCAAGC
TGACTCGACGGGACCTGAGCAACTGGGACACCGTCTCTCAGAATTGGGTCGTGACGAAGCACCCCAAAAAGGTCT
GGGTCGGCAGCAGCTCGCGCAACCTGCCTCTCCATGCGACGCTGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail