Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5735
Gene name
LocationContig_289:6044..7268
Strand-
Gene length (bp)1224
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01391 Collagen Collagen triple helix repeat (20 copies) 3.9E-09 109 166
PF01391 Collagen Collagen triple helix repeat (20 copies) 4.2E-07 154 206
PF01391 Collagen Collagen triple helix repeat (20 copies) 1.5E-09 289 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 359 2.0E-33
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 109 359 2.0E-30
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 347 5.0E-28
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 85 387 1.0E-26
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 109 346 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 359 2.0E-33
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 109 359 2.0E-30
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 347 5.0E-28
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 85 387 1.0E-26
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 109 346 2.0E-26
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 109 348 6.0E-26
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 107 351 7.0E-26
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 111 340 7.0E-26
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 107 353 8.0E-26
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 107 346 1.0E-25
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 107 348 1.0E-25
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 109 359 1.0E-25
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 104 346 2.0E-25
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 109 347 3.0E-25
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 112 346 3.0E-25
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 115 347 6.0E-25
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 108 339 6.0E-25
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 346 7.0E-25
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 111 346 8.0E-25
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 107 348 8.0E-25
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 115 347 1.0E-24
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 348 1.0E-24
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 104 346 2.0E-24
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 108 348 2.0E-24
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 347 4.0E-24
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 112 326 4.0E-24
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 108 348 4.0E-24
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 118 350 5.0E-24
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 120 331 5.0E-24
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 135 347 7.0E-24
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 118 362 1.0E-23
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 104 348 1.0E-23
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 118 348 1.0E-23
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 98 346 1.0E-23
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 109 347 2.0E-23
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 104 349 2.0E-23
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 109 347 3.0E-23
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 105 346 3.0E-23
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 108 348 3.0E-23
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 109 343 3.0E-23
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 109 347 3.0E-23
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 104 346 3.0E-23
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 123 348 3.0E-23
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 107 347 5.0E-23
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 126 344 6.0E-23
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 107 326 9.0E-23
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 346 1.0E-22
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 109 348 1.0E-22
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 109 353 1.0E-22
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 113 347 2.0E-22
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 109 328 2.0E-22
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 109 344 2.0E-22
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 347 3.0E-22
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 320 3.0E-22
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 109 344 3.0E-22
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 351 3.0E-22
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 105 339 4.0E-22
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 107 348 4.0E-22
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 353 6.0E-22
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 108 347 7.0E-22
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 115 351 8.0E-22
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 94 346 1.0E-21
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 112 357 1.0E-21
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 118 347 2.0E-21
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 109 331 2.0E-21
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 348 2.0E-21
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 109 346 2.0E-21
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 85 346 3.0E-21
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 347 4.0E-21
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 108 346 4.0E-21
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 108 350 4.0E-21
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 112 346 5.0E-21
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 115 380 9.0E-21
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 112 347 1.0E-20
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 109 347 2.0E-20
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 58 335 2.0E-20
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 346 2.0E-20
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 115 346 2.0E-20
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 109 346 2.0E-20
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 111 348 2.0E-20
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 109 351 2.0E-20
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 109 344 3.0E-20
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 104 346 3.0E-20
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 124 347 3.0E-20
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 109 336 4.0E-20
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 100 335 4.0E-20
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 108 339 5.0E-20
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 104 347 5.0E-20
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 109 347 5.0E-20
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 108 347 6.0E-20
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 346 7.0E-20
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 148 348 7.0E-20
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 108 346 8.0E-20
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 109 348 8.0E-20
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 123 347 8.0E-20
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 108 343 9.0E-20
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 109 351 9.0E-20
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 109 348 9.0E-20
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 108 346 1.0E-19
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 346 1.0E-19
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 109 346 1.0E-19
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 109 393 1.0E-19
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 109 360 1.0E-19
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 339 2.0E-19
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 343 2.0E-19
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 107 347 3.0E-19
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 65 346 3.0E-19
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 115 348 3.0E-19
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 114 346 3.0E-19
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 124 343 3.0E-19
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 109 347 4.0E-19
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 109 338 4.0E-19
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 121 328 4.0E-19
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 109 348 4.0E-19
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 112 341 5.0E-19
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 109 351 6.0E-19
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 104 346 6.0E-19
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 109 360 6.0E-19
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 348 6.0E-19
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 107 381 7.0E-19
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 112 347 9.0E-19
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 107 346 1.0E-18
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 346 1.0E-18
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 104 340 1.0E-18
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 105 347 1.0E-18
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 112 348 1.0E-18
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 133 344 1.0E-18
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 109 310 1.0E-18
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 109 316 1.0E-18
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 2 379 2.0E-18
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 104 346 2.0E-18
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 104 344 2.0E-18
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 63 353 2.0E-18
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 145 347 3.0E-18
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 109 351 3.0E-18
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 124 310 3.0E-18
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 109 355 3.0E-18
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 109 350 3.0E-18
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 104 362 3.0E-18
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 86 346 4.0E-18
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 336 4.0E-18
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 109 336 4.0E-18
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 107 346 5.0E-18
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 109 329 5.0E-18
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 115 298 6.0E-18
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 118 340 6.0E-18
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 118 360 7.0E-18
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 108 343 8.0E-18
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 163 348 9.0E-18
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 157 346 9.0E-18
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 104 331 1.0E-17
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 107 346 1.0E-17
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 115 343 1.0E-17
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 304 1.0E-17
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 86 331 1.0E-17
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 109 347 1.0E-17
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 107 354 2.0E-17
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 86 347 2.0E-17
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 92 345 2.0E-17
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 108 353 2.0E-17
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 109 336 2.0E-17
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 167 359 2.0E-17
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 109 337 2.0E-17
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 121 298 2.0E-17
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 109 316 2.0E-17
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 124 347 2.0E-17
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 109 336 2.0E-17
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 142 353 3.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 109 343 3.0E-17
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 115 359 3.0E-17
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 107 346 3.0E-17
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 112 336 3.0E-17
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 109 347 3.0E-17
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 108 339 3.0E-17
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 108 351 4.0E-17
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 206 346 4.0E-17
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 109 346 5.0E-17
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 112 322 5.0E-17
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 109 347 5.0E-17
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 346 6.0E-17
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 140 347 6.0E-17
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 108 298 7.0E-17
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 105 347 7.0E-17
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 109 347 7.0E-17
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 145 346 8.0E-17
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 145 351 9.0E-17
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 109 346 1.0E-16
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 351 1.0E-16
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 107 325 1.0E-16
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 115 346 1.0E-16
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 112 347 1.0E-16
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 112 343 1.0E-16
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 108 347 1.0E-16
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 331 2.0E-16
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 343 2.0E-16
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 338 2.0E-16
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 125 348 2.0E-16
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 138 346 2.0E-16
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 109 348 2.0E-16
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 109 340 2.0E-16
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 112 348 3.0E-16
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 107 351 3.0E-16
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 121 347 3.0E-16
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 118 347 3.0E-16
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 105 346 3.0E-16
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 5 265 3.0E-16
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 111 346 3.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 168 348 4.0E-16
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 126 340 4.0E-16
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 343 4.0E-16
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 49 341 4.0E-16
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 109 319 4.0E-16
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 127 253 4.0E-16
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 125 346 5.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 107 346 5.0E-16
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 109 295 5.0E-16
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 168 343 5.0E-16
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 109 377 5.0E-16
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 98 348 5.0E-16
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 112 346 5.0E-16
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 346 6.0E-16
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 112 346 6.0E-16
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 122 347 6.0E-16
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 85 346 6.0E-16
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 109 328 6.0E-16
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 174 346 6.0E-16
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 109 334 7.0E-16
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 92 351 7.0E-16
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 121 348 8.0E-16
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 112 348 8.0E-16
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 363 9.0E-16
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 109 363 9.0E-16
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 109 359 9.0E-16
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 127 338 1.0E-15
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 107 340 1.0E-15
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 139 348 1.0E-15
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 109 351 1.0E-15
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 118 341 1.0E-15
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 123 335 1.0E-15
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 113 321 1.0E-15
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 109 347 2.0E-15
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 108 346 2.0E-15
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 110 351 2.0E-15
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 109 346 2.0E-15
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 138 344 2.0E-15
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 78 346 2.0E-15
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 160 329 2.0E-15
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 109 347 2.0E-15
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 112 346 2.0E-15
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 109 351 2.0E-15
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 112 348 3.0E-15
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 351 3.0E-15
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 123 346 3.0E-15
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 109 329 3.0E-15
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 115 346 3.0E-15
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 112 347 4.0E-15
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 115 351 4.0E-15
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 362 4.0E-15
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 112 348 4.0E-15
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 109 338 4.0E-15
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 112 347 4.0E-15
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 109 335 4.0E-15
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 107 336 4.0E-15
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 132 348 4.0E-15
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 112 387 5.0E-15
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 106 359 6.0E-15
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 130 338 6.0E-15
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 104 338 6.0E-15
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 109 351 6.0E-15
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 145 340 7.0E-15
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 109 346 7.0E-15
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 107 347 7.0E-15
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 348 7.0E-15
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 109 351 7.0E-15
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 93 326 7.0E-15
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 104 343 7.0E-15
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 176 387 7.0E-15
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 112 346 8.0E-15
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 109 346 8.0E-15
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 121 348 8.0E-15
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 109 351 9.0E-15
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 145 346 9.0E-15
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 92 346 9.0E-15
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 109 348 1.0E-14
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 199 359 1.0E-14
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 168 346 1.0E-14
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 109 348 1.0E-14
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 109 346 1.0E-14
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 107 331 1.0E-14
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 109 347 1.0E-14
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 23 348 2.0E-14
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 142 348 2.0E-14
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 42 348 2.0E-14
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 105 348 2.0E-14
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 117 351 2.0E-14
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 108 346 2.0E-14
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 109 347 2.0E-14
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 108 347 2.0E-14
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 77 336 2.0E-14
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 118 346 2.0E-14
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 109 346 3.0E-14
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 133 347 3.0E-14
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 110 346 3.0E-14
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 109 335 3.0E-14
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 102 369 3.0E-14
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 115 353 3.0E-14
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 122 347 3.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 90 297 3.0E-14
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 71 349 3.0E-14
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 124 347 3.0E-14
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 109 336 4.0E-14
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 112 357 4.0E-14
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 109 331 4.0E-14
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 128 346 4.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 140 346 5.0E-14
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 114 366 5.0E-14
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 115 346 5.0E-14
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 107 331 5.0E-14
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 110 353 5.0E-14
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 109 346 6.0E-14
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 108 348 6.0E-14
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 129 346 6.0E-14
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 99 297 6.0E-14
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 124 348 7.0E-14
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 115 328 8.0E-14
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 140 351 9.0E-14
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 127 348 9.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 90 297 9.0E-14
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 104 331 9.0E-14
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 109 346 1.0E-13
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 338 1.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 141 347 1.0E-13
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 85 353 1.0E-13
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 115 347 1.0E-13
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 108 343 1.0E-13
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 136 347 1.0E-13
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 114 351 1.0E-13
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 62 343 1.0E-13
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 104 375 1.0E-13
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 92 348 1.0E-13
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 107 348 1.0E-13
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 145 347 1.0E-13
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 113 346 1.0E-13
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 179 319 1.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 176 387 1.0E-13
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 107 344 1.0E-13
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 10 346 1.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 109 346 2.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 116 354 2.0E-13
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 109 348 2.0E-13
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 104 349 2.0E-13
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 115 353 3.0E-13
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 174 360 3.0E-13
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 114 338 3.0E-13
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 107 348 3.0E-13
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 109 323 3.0E-13
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 158 346 4.0E-13
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 115 307 4.0E-13
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 171 347 4.0E-13
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 109 340 4.0E-13
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 127 344 4.0E-13
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 72 238 4.0E-13
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 127 344 4.0E-13
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 108 348 4.0E-13
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 336 4.0E-13
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 127 344 4.0E-13
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 104 343 5.0E-13
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 108 348 5.0E-13
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 109 313 5.0E-13
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 107 347 5.0E-13
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 115 320 5.0E-13
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 115 349 5.0E-13
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 139 359 6.0E-13
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 85 313 7.0E-13
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 347 7.0E-13
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 205 338 7.0E-13
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 109 346 7.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 112 346 8.0E-13
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 71 337 8.0E-13
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 347 9.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 107 328 9.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 111 357 9.0E-13
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 104 348 1.0E-12
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 112 340 1.0E-12
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 117 331 1.0E-12
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 112 396 1.0E-12
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 109 348 1.0E-12
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 107 347 1.0E-12
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 133 344 1.0E-12
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 121 347 1.0E-12
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 126 308 1.0E-12
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 96 339 1.0E-12
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 104 346 1.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 109 270 1.0E-12
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 109 348 1.0E-12
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 108 346 1.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 121 348 2.0E-12
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 215 346 2.0E-12
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 109 268 2.0E-12
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 98 348 2.0E-12
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 109 347 2.0E-12
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 111 346 2.0E-12
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 109 326 2.0E-12
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 177 346 2.0E-12
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 104 348 2.0E-12
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 133 347 2.0E-12
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 115 347 2.0E-12
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 115 352 2.0E-12
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 141 305 2.0E-12
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 107 348 3.0E-12
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 104 331 3.0E-12
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 109 346 3.0E-12
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 109 347 3.0E-12
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 107 296 3.0E-12
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 104 340 3.0E-12
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 351 3.0E-12
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 126 346 3.0E-12
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 105 302 3.0E-12
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 163 348 3.0E-12
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 112 270 3.0E-12
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 181 301 3.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 163 330 4.0E-12
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 139 346 4.0E-12
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 109 343 4.0E-12
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 167 346 4.0E-12
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 178 346 4.0E-12
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 110 348 4.0E-12
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 165 330 5.0E-12
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 112 348 5.0E-12
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 104 348 5.0E-12
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 109 346 5.0E-12
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 104 371 5.0E-12
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 109 348 6.0E-12
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 112 346 6.0E-12
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 109 347 6.0E-12
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 109 340 7.0E-12
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 109 348 7.0E-12
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 126 307 7.0E-12
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 128 351 7.0E-12
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 90 301 7.0E-12
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 124 348 7.0E-12
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 256 8.0E-12
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 346 8.0E-12
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 178 351 8.0E-12
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 21 346 8.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 112 317 8.0E-12
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 109 299 8.0E-12
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 109 347 8.0E-12
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 109 270 8.0E-12
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 214 347 9.0E-12
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 118 316 9.0E-12
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 112 346 9.0E-12
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 108 344 1.0E-11
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 112 340 1.0E-11
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 163 347 1.0E-11
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 107 346 1.0E-11
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 125 334 1.0E-11
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 163 346 1.0E-11
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 109 348 1.0E-11
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 87 343 1.0E-11
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 104 351 1.0E-11
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 109 351 1.0E-11
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 133 343 1.0E-11
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 109 346 1.0E-11
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 109 351 1.0E-11
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 141 346 1.0E-11
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 109 344 1.0E-11
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 115 363 1.0E-11
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 347 1.0E-11
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 108 349 1.0E-11
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 108 334 1.0E-11
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 112 349 1.0E-11
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 181 347 2.0E-11
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 109 346 2.0E-11
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 108 340 2.0E-11
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 109 291 2.0E-11
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 112 331 2.0E-11
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 153 346 2.0E-11
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 111 354 2.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 201 346 2.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 190 344 2.0E-11
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 347 2.0E-11
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 129 347 2.0E-11
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 109 346 2.0E-11
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 105 346 2.0E-11
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 109 346 2.0E-11
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 102 343 2.0E-11
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 125 326 2.0E-11
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 109 348 2.0E-11
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 109 364 2.0E-11
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 133 347 3.0E-11
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 100 347 3.0E-11
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 112 346 3.0E-11
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 141 400 3.0E-11
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 109 298 3.0E-11
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 109 362 4.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 213 347 4.0E-11
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 107 346 4.0E-11
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 109 339 4.0E-11
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 109 346 4.0E-11
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 142 359 4.0E-11
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 126 347 4.0E-11
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 104 377 4.0E-11
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 108 346 5.0E-11
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 117 351 5.0E-11
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 109 351 5.0E-11
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 86 357 5.0E-11
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 121 346 5.0E-11
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 121 346 5.0E-11
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 109 348 5.0E-11
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 77 336 5.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 109 298 5.0E-11
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 191 346 5.0E-11
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 102 254 5.0E-11
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 124 296 6.0E-11
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 147 390 6.0E-11
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 166 335 7.0E-11
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 109 347 7.0E-11
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 121 346 7.0E-11
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 121 346 7.0E-11
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 118 343 7.0E-11
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 112 346 7.0E-11
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 172 347 8.0E-11
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 107 347 8.0E-11
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 104 338 8.0E-11
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 104 340 9.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 109 353 9.0E-11
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 112 256 9.0E-11
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 86 331 9.0E-11
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 109 322 1.0E-10
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 126 347 1.0E-10
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 107 328 1.0E-10
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 109 348 1.0E-10
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 112 346 1.0E-10
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 106 354 1.0E-10
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 115 286 1.0E-10
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 109 319 2.0E-10
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 112 258 2.0E-10
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 111 357 2.0E-10
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 126 348 2.0E-10
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 346 2.0E-10
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 348 2.0E-10
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 109 249 2.0E-10
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 346 2.0E-10
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 133 338 2.0E-10
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 109 317 2.0E-10
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 107 343 2.0E-10
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 346 2.0E-10
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 145 346 2.0E-10
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 109 334 2.0E-10
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 93 262 2.0E-10
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 129 346 2.0E-10
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 214 343 2.0E-10
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 107 264 2.0E-10
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 142 298 2.0E-10
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 106 325 2.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 331 3.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 109 306 3.0E-10
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 109 339 3.0E-10
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 109 260 3.0E-10
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 112 346 3.0E-10
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 129 354 3.0E-10
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 123 346 3.0E-10
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 172 400 3.0E-10
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 130 340 3.0E-10
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 191 390 3.0E-10
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 122 347 3.0E-10
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 140 347 4.0E-10
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 156 353 4.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 107 338 4.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 107 346 4.0E-10
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 109 281 4.0E-10
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 108 293 4.0E-10
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 121 343 4.0E-10
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 351 4.0E-10
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 351 4.0E-10
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 142 270 4.0E-10
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 167 346 5.0E-10
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 38 347 5.0E-10
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 109 346 5.0E-10
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 136 347 5.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 136 347 5.0E-10
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 204 346 5.0E-10
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 114 311 5.0E-10
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 108 331 5.0E-10
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 101 299 5.0E-10
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 112 347 6.0E-10
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 129 331 6.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 136 347 6.0E-10
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 129 331 6.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 140 346 7.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 125 339 7.0E-10
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 118 346 7.0E-10
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 108 318 7.0E-10
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 112 349 7.0E-10
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 203 343 7.0E-10
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 115 346 7.0E-10
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 80 295 8.0E-10
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 148 348 8.0E-10
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 109 356 9.0E-10
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 127 318 9.0E-10
sp|P50404|SFTPD_MOUSE Pulmonary surfactant-associated protein D OS=Mus musculus GN=Sftpd PE=1 SV=1 129 256 9.0E-10
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 120 353 1.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 104 359 1.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 109 347 1.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 112 350 1.0E-09
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 121 354 1.0E-09
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 115 344 1.0E-09
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 107 320 1.0E-09
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 130 381 1.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 176 355 1.0E-09
sp|P50404|SFTPD_MOUSE Pulmonary surfactant-associated protein D OS=Mus musculus GN=Sftpd PE=1 SV=1 186 375 1.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 109 249 2.0E-09
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 125 332 2.0E-09
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 108 279 2.0E-09
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 109 346 2.0E-09
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 107 353 2.0E-09
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 108 340 2.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 114 346 2.0E-09
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 127 318 2.0E-09
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 126 347 2.0E-09
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 112 277 2.0E-09
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 112 304 2.0E-09
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 122 360 2.0E-09
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 111 296 2.0E-09
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 121 226 2.0E-09
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 95 307 2.0E-09
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 121 343 3.0E-09
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 108 329 3.0E-09
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 347 3.0E-09
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 104 349 3.0E-09
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 126 334 3.0E-09
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 138 331 3.0E-09
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 340 3.0E-09
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 104 347 3.0E-09
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 141 357 3.0E-09
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 193 375 3.0E-09
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 121 346 4.0E-09
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 107 344 4.0E-09
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 208 351 4.0E-09
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 184 348 4.0E-09
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 109 295 4.0E-09
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 218 347 4.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 145 348 4.0E-09
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 104 334 4.0E-09
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 109 235 4.0E-09
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 84 347 5.0E-09
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 115 330 5.0E-09
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 178 347 5.0E-09
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 81 268 5.0E-09
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 126 347 5.0E-09
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 115 343 5.0E-09
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 139 347 5.0E-09
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 111 235 6.0E-09
sp|C0HJN7|CO1A1_TAPTE Collagen alpha-1(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A1 PE=1 SV=1 130 348 6.0E-09
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 76 347 7.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 128 338 7.0E-09
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 119 343 7.0E-09
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 112 357 7.0E-09
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 123 337 8.0E-09
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 346 8.0E-09
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 108 250 9.0E-09
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 109 348 9.0E-09
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 96 254 9.0E-09
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 109 259 1.0E-08
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 86 232 1.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 115 340 1.0E-08
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 130 346 1.0E-08
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 109 346 1.0E-08
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 109 346 1.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 115 338 1.0E-08
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 109 346 1.0E-08
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 126 347 1.0E-08
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 189 375 1.0E-08
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 175 347 1.0E-08
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 109 347 1.0E-08
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 115 347 1.0E-08
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 148 297 1.0E-08
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 109 348 1.0E-08
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 109 197 1.0E-08
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 191 390 1.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 140 346 2.0E-08
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 118 312 2.0E-08
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 115 348 2.0E-08
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 109 325 2.0E-08
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 148 362 2.0E-08
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 92 290 2.0E-08
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 109 347 2.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 109 329 2.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 109 347 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 76 347 2.0E-08
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 112 347 2.0E-08
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 104 351 2.0E-08
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 109 348 2.0E-08
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 109 331 2.0E-08
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 109 348 2.0E-08
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 165 329 2.0E-08
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 109 334 2.0E-08
sp|Q5UPS6|COLL5_MIMIV Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R241 PE=4 SV=1 102 346 2.0E-08
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 108 235 3.0E-08
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 160 286 3.0E-08
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 112 311 3.0E-08
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 130 346 3.0E-08
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 136 321 3.0E-08
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 109 346 3.0E-08
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 207 337 3.0E-08
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 109 346 3.0E-08
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 104 346 3.0E-08
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 127 344 3.0E-08
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 95 251 3.0E-08
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 163 259 3.0E-08
sp|Q03692|COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2 109 277 3.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 76 348 4.0E-08
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 262 4.0E-08
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 109 343 4.0E-08
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 109 346 4.0E-08
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 109 323 4.0E-08
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 193 390 4.0E-08
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 175 299 4.0E-08
sp|P20784|ROL6_CAEEL Cuticle collagen rol-6 OS=Caenorhabditis elegans GN=rol-6 PE=3 SV=1 105 257 4.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 197 347 5.0E-08
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 251 5.0E-08
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 107 354 5.0E-08
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 109 347 5.0E-08
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 115 344 5.0E-08
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 176 332 5.0E-08
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 104 346 5.0E-08
sp|C0HJN5|CO1A1_HIPAM Collagen alpha-1(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A1 PE=1 SV=1 132 314 5.0E-08
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 212 347 6.0E-08
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 188 347 6.0E-08
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 108 251 6.0E-08
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 147 297 6.0E-08
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 108 349 6.0E-08
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 108 304 7.0E-08
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 109 353 7.0E-08
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 112 346 7.0E-08
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 110 205 8.0E-08
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 166 346 8.0E-08
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 128 364 8.0E-08
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 87 244 8.0E-08
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 115 296 8.0E-08
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 104 336 9.0E-08
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 106 289 9.0E-08
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 104 245 9.0E-08
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 115 347 9.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 111 346 9.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 115 346 1.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 101 308 1.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 147 315 1.0E-07
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 108 351 1.0E-07
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 148 302 1.0E-07
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 106 251 1.0E-07
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 210 350 1.0E-07
sp|P31720|C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus GN=C1qa PE=1 SV=2 171 241 1.0E-07
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 109 257 2.0E-07
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 107 235 2.0E-07
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 109 346 2.0E-07
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 101 340 2.0E-07
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 104 351 2.0E-07
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 96 238 2.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 107 280 2.0E-07
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 328 2.0E-07
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 138 301 2.0E-07
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 113 346 2.0E-07
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 109 310 2.0E-07
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 107 346 2.0E-07
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 112 347 2.0E-07
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 57 325 2.0E-07
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 109 343 2.0E-07
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 145 353 2.0E-07
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 109 346 2.0E-07
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 112 296 2.0E-07
sp|Q86Y22|CONA1_HUMAN Collagen alpha-1(XXIII) chain OS=Homo sapiens GN=COL23A1 PE=1 SV=1 151 346 2.0E-07
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 109 348 3.0E-07
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 108 262 3.0E-07
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 107 343 3.0E-07
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 147 343 3.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 169 307 3.0E-07
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 109 313 3.0E-07
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 112 273 3.0E-07
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 133 351 3.0E-07
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 85 346 3.0E-07
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 110 347 3.0E-07
sp|C0HJP1|CO1A1_CYCDI Collagen alpha-1(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A1 PE=1 SV=1 109 362 3.0E-07
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 178 244 3.0E-07
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 108 347 4.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 109 344 4.0E-07
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 104 308 4.0E-07
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 130 316 4.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 129 303 4.0E-07
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 115 337 5.0E-07
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 211 348 5.0E-07
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 109 322 5.0E-07
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 95 356 5.0E-07
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 167 347 5.0E-07
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 112 346 5.0E-07
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 130 295 5.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 130 346 5.0E-07
sp|Q25460|FP1_MYTED Adhesive plaque matrix protein (Fragment) OS=Mytilus edulis GN=FP1 PE=1 SV=1 44 381 5.0E-07
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 85 312 6.0E-07
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 160 348 6.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 128 347 6.0E-07
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 136 359 6.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 85 261 7.0E-07
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 140 347 8.0E-07
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 107 347 8.0E-07
sp|C0HJN7|CO1A1_TAPTE Collagen alpha-1(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A1 PE=1 SV=1 129 347 8.0E-07
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 183 303 8.0E-07
sp|Q5RFW0|SCAR5_DANRE Scavenger receptor class A member 5 OS=Danio rerio GN=scara5 PE=3 SV=1 200 283 8.0E-07
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 103 346 9.0E-07
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 132 352 9.0E-07
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 137 344 9.0E-07
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 118 263 1.0E-06
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 109 346 1.0E-06
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 121 347 1.0E-06
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 109 351 1.0E-06
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 131 262 1.0E-06
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 107 337 1.0E-06
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 136 343 1.0E-06
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 122 348 1.0E-06
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 109 272 1.0E-06
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 109 351 1.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 109 295 1.0E-06
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 86 331 1.0E-06
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 109 295 1.0E-06
sp|Q17460|COL10_CAEEL Cuticle collagen 10 OS=Caenorhabditis elegans GN=col-10 PE=2 SV=1 214 322 1.0E-06
sp|C0HJN9|CO1A1_EQUSP Collagen alpha-1(I) chain (Fragments) OS=Equus sp. GN=COL1A1 PE=1 SV=1 108 312 1.0E-06
sp|Q9XSW3|MBL2_PIG Mannose-binding protein C OS=Sus scrofa GN=MBL2 PE=1 SV=1 186 252 1.0E-06
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 109 268 1.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 171 241 1.0E-06
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 112 346 2.0E-06
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 130 268 2.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 109 263 2.0E-06
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 91 336 2.0E-06
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 147 348 2.0E-06
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 157 346 2.0E-06
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 91 266 2.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 114 280 2.0E-06
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 109 347 2.0E-06
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 179 289 2.0E-06
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 208 341 2.0E-06
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 108 359 2.0E-06
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 205 313 2.0E-06
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 111 298 2.0E-06
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 112 349 2.0E-06
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 165 299 2.0E-06
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 235 347 2.0E-06
sp|P55787|CO4A4_RABIT Collagen alpha-4(IV) chain (Fragment) OS=Oryctolagus cuniculus GN=COL4A4 PE=2 SV=1 198 304 2.0E-06
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 184 346 3.0E-06
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 218 353 3.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 170 267 3.0E-06
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 109 347 3.0E-06
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 107 347 3.0E-06
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 165 280 3.0E-06
sp|Q810Y4|CONA1_RAT Collagen alpha-1(XXIII) chain OS=Rattus norvegicus GN=Col23a1 PE=1 SV=1 144 346 3.0E-06
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 222 334 3.0E-06
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 115 282 3.0E-06
sp|C0HJP3|CO1A1_MYLDA Collagen alpha-1(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A1 PE=1 SV=1 174 314 3.0E-06
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 227 335 4.0E-06
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 108 307 4.0E-06
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 104 330 4.0E-06
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 151 340 4.0E-06
sp|C0HJP3|CO1A1_MYLDA Collagen alpha-1(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A1 PE=1 SV=1 115 312 4.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 159 245 4.0E-06
sp|Q9N1X4|SFTPD_PIG Pulmonary surfactant-associated protein D OS=Sus scrofa GN=SFTPD PE=1 SV=1 189 375 4.0E-06
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 122 348 5.0E-06
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 195 346 5.0E-06
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 86 256 5.0E-06
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 107 237 5.0E-06
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 188 347 5.0E-06
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 127 338 5.0E-06
sp|Q02105|C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus GN=C1qc PE=1 SV=2 181 241 5.0E-06
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 109 325 6.0E-06
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 181 322 6.0E-06
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 109 217 6.0E-06
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 110 278 6.0E-06
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 190 295 6.0E-06
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 86 256 6.0E-06
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 86 256 6.0E-06
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 188 346 6.0E-06
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 124 349 6.0E-06
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 96 347 6.0E-06
sp|C0HJN5|CO1A1_HIPAM Collagen alpha-1(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A1 PE=1 SV=1 121 351 6.0E-06
sp|P31720|C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus GN=C1qa PE=1 SV=2 229 360 6.0E-06
sp|Q810Y4|CONA1_RAT Collagen alpha-1(XXIII) chain OS=Rattus norvegicus GN=Col23a1 PE=1 SV=1 130 310 6.0E-06
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 109 263 7.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 112 343 7.0E-06
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 109 331 7.0E-06
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 148 301 7.0E-06
sp|C0HJN5|CO1A1_HIPAM Collagen alpha-1(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A1 PE=1 SV=1 82 348 7.0E-06
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 167 285 7.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 163 256 7.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 159 256 7.0E-06
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 109 304 8.0E-06
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 109 319 8.0E-06
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 96 343 8.0E-06
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 122 235 8.0E-06
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 126 223 9.0E-06
sp|C0HJN7|CO1A1_TAPTE Collagen alpha-1(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A1 PE=1 SV=1 126 223 9.0E-06
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 73 352 9.0E-06
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 221 338 9.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 179 247 9.0E-06
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 219 343 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5735
MKIEAVAAIVAFAGNCLAAPKVEAGLAGYGSYDKPKAYGNKGDSYSADYKNKDSYGAGYKKDSYDAGSKGKDSYG
KDDDSYDDDDDGKPAYGAKKSYGEEKSYEKPSYGKTGPPGPPGPPGKPGKDGYDGKPGRPGYDGKPGPIGPHGKP
GRPGYDGKPGPIGPPGKNGKNGYDGKPGIPGPPGPPGVNGKPGHPGKDGYDGKQGPAGPPGRPGPPGPPGPPGPP
GPPGPPGKPGVPGPPGPPGKPGKNGYDGKPGRPGKDGYDGKPGPIGPVGPPGKHGRPGRPGKDGYDGKPGRPGYD
GKPGPVGPPGKNGKDGYDGKQGPPGPPGKTGRPGYNGKQGPPGPPGKTVYPKPSYEKKEPSYEKKESTYKKEPTY
KKKPAYKKESSYGKKEESKDDGYGRKDNSNGY*
Coding >Hirsu2|5735
ATGAAGATCGAGGCCGTCGCCGCCATCGTGGCCTTCGCCGGCAACTGCCTGGCCGCCCCCAAGGTGGAGGCCGGC
CTGGCGGGGTATGGCTCCTACGACAAGCCCAAGGCCTACGGCAACAAGGGCGACTCGTACAGCGCCGACTACAAG
AACAAGGACTCGTACGGCGCCGGCTACAAGAAGGACTCGTATGACGCCGGCTCCAAGGGCAAGGACTCGTACGGC
AAGGACGACGACTCGTACGACGACGACGACGACGGCAAGCCCGCCTACGGTGCCAAGAAGTCGTACGGCGAGGAG
AAGTCGTACGAGAAGCCCTCGTACGGCAAGACCGGCCCCCCCGGGCCCCCCGGCCCCCCCGGCAAGCCGGGCAAG
GACGGCTACGACGGCAAGCCCGGCCGCCCTGGCTACGACGGCAAGCCGGGCCCCATCGGCCCCCACGGCAAGCCC
GGCCGCCCTGGCTACGATGGCAAGCCGGGCCCCATCGGCCCCCCGGGCAAGAACGGCAAGAACGGCTATGATGGC
AAGCCGGGCATCCCCGGCCCCCCGGGCCCGCCCGGCGTGAATGGCAAGCCCGGCCACCCTGGCAAGGATGGATAT
GATGGCAAGCAGGGCCCCGCCGGCCCCCCGGGCCGCCCCGGACCCCCGGGACCCCCCGGTCCCCCCGGTCCCCCC
GGTCCCCCGGGACCTCCCGGCAAGCCTGGTGTCCCCGGTCCCCCGGGCCCCCCCGGCAAGCCGGGCAAGAACGGC
TACGATGGCAAGCCCGGCCGCCCTGGTAAGGACGGCTACGATGGCAAGCCCGGCCCCATTGGCCCCGTTGGCCCC
CCCGGTAAGCACGGCAGGCCCGGCCGCCCTGGCAAGGACGGCTACGATGGCAAGCCCGGCCGCCCTGGCTACGAT
GGCAAGCCCGGCCCCGTCGGTCCCCCGGGCAAGAACGGCAAGGACGGTTACGATGGCAAGCAGGGTCCTCCCGGC
CCCCCTGGCAAGACCGGCCGTCCTGGCTACAATGGCAAGCAGGGCCCTCCCGGACCGCCCGGAAAGACCGTCTAC
CCCAAGCCCAGCTACGAGAAGAAGGAGCCGAGCTACGAGAAGAAGGAGTCCACCTACAAGAAGGAGCCCACCTAC
AAGAAGAAGCCTGCCTACAAGAAGGAGTCCAGCTACGGCAAGAAGGAGGAGTCCAAGGACGATGGCTACGGCAGG
AAGGACAACTCCAACGGCTACTAA
Transcript >Hirsu2|5735
ATGAAGATCGAGGCCGTCGCCGCCATCGTGGCCTTCGCCGGCAACTGCCTGGCCGCCCCCAAGGTGGAGGCCGGC
CTGGCGGGGTATGGCTCCTACGACAAGCCCAAGGCCTACGGCAACAAGGGCGACTCGTACAGCGCCGACTACAAG
AACAAGGACTCGTACGGCGCCGGCTACAAGAAGGACTCGTATGACGCCGGCTCCAAGGGCAAGGACTCGTACGGC
AAGGACGACGACTCGTACGACGACGACGACGACGGCAAGCCCGCCTACGGTGCCAAGAAGTCGTACGGCGAGGAG
AAGTCGTACGAGAAGCCCTCGTACGGCAAGACCGGCCCCCCCGGGCCCCCCGGCCCCCCCGGCAAGCCGGGCAAG
GACGGCTACGACGGCAAGCCCGGCCGCCCTGGCTACGACGGCAAGCCGGGCCCCATCGGCCCCCACGGCAAGCCC
GGCCGCCCTGGCTACGATGGCAAGCCGGGCCCCATCGGCCCCCCGGGCAAGAACGGCAAGAACGGCTATGATGGC
AAGCCGGGCATCCCCGGCCCCCCGGGCCCGCCCGGCGTGAATGGCAAGCCCGGCCACCCTGGCAAGGATGGATAT
GATGGCAAGCAGGGCCCCGCCGGCCCCCCGGGCCGCCCCGGACCCCCGGGACCCCCCGGTCCCCCCGGTCCCCCC
GGTCCCCCGGGACCTCCCGGCAAGCCTGGTGTCCCCGGTCCCCCGGGCCCCCCCGGCAAGCCGGGCAAGAACGGC
TACGATGGCAAGCCCGGCCGCCCTGGTAAGGACGGCTACGATGGCAAGCCCGGCCCCATTGGCCCCGTTGGCCCC
CCCGGTAAGCACGGCAGGCCCGGCCGCCCTGGCAAGGACGGCTACGATGGCAAGCCCGGCCGCCCTGGCTACGAT
GGCAAGCCCGGCCCCGTCGGTCCCCCGGGCAAGAACGGCAAGGACGGTTACGATGGCAAGCAGGGTCCTCCCGGC
CCCCCTGGCAAGACCGGCCGTCCTGGCTACAATGGCAAGCAGGGCCCTCCCGGACCGCCCGGAAAGACCGTCTAC
CCCAAGCCCAGCTACGAGAAGAAGGAGCCGAGCTACGAGAAGAAGGAGTCCACCTACAAGAAGGAGCCCACCTAC
AAGAAGAAGCCTGCCTACAAGAAGGAGTCCAGCTACGGCAAGAAGGAGGAGTCCAAGGACGATGGCTACGGCAGG
AAGGACAACTCCAACGGCTACTAA
Gene >Hirsu2|5735
ATGAAGATCGAGGCCGTCGCCGCCATCGTGGCCTTCGCCGGCAACTGCCTGGCCGCCCCCAAGGTGGAGGCCGGC
CTGGCGGGGTATGGCTCCTACGACAAGCCCAAGGCCTACGGCAACAAGGGCGACTCGTACAGCGCCGACTACAAG
AACAAGGACTCGTACGGCGCCGGCTACAAGAAGGACTCGTATGACGCCGGCTCCAAGGGCAAGGACTCGTACGGC
AAGGACGACGACTCGTACGACGACGACGACGACGGCAAGCCCGCCTACGGTGCCAAGAAGTCGTACGGCGAGGAG
AAGTCGTACGAGAAGCCCTCGTACGGCAAGACCGGCCCCCCCGGGCCCCCCGGCCCCCCCGGCAAGCCGGGCAAG
GACGGCTACGACGGCAAGCCCGGCCGCCCTGGCTACGACGGCAAGCCGGGCCCCATCGGCCCCCACGGCAAGCCC
GGCCGCCCTGGCTACGATGGCAAGCCGGGCCCCATCGGCCCCCCGGGCAAGAACGGCAAGAACGGCTATGATGGC
AAGCCGGGCATCCCCGGCCCCCCGGGCCCGCCCGGCGTGAATGGCAAGCCCGGCCACCCTGGCAAGGATGGATAT
GATGGCAAGCAGGGCCCCGCCGGCCCCCCGGGCCGCCCCGGACCCCCGGGACCCCCCGGTCCCCCCGGTCCCCCC
GGTCCCCCGGGACCTCCCGGCAAGCCTGGTGTCCCCGGTCCCCCGGGCCCCCCCGGCAAGCCGGGCAAGAACGGC
TACGATGGCAAGCCCGGCCGCCCTGGTAAGGACGGCTACGATGGCAAGCCCGGCCCCATTGGCCCCGTTGGCCCC
CCCGGTAAGCACGGCAGGCCCGGCCGCCCTGGCAAGGACGGCTACGATGGCAAGCCCGGCCGCCCTGGCTACGAT
GGCAAGCCCGGCCCCGTCGGTCCCCCGGGCAAGAACGGCAAGGACGGTTACGATGGCAAGCAGGGTCCTCCCGGC
CCCCCTGGCAAGACCGGCCGTCCTGGCTACAATGGCAAGCAGGGCCCTCCCGGACCGCCCGGAAAGACCGTCTAC
CCCAAGCCCAGCTACGAGAAGAAGGAGCCGAGCTACGAGAAGAAGGAGTCCACCTACAAGAAGGAGCCCACCTAC
AAGAAGAAGCCTGCCTACAAGAAGGAGTCCAGCTACGGCAAGAAGGAGGAGTCCAAGGACGATGGCTACGGCAGG
AAGGACAACTCCAACGGCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail