Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5734
Gene name
LocationContig_289:3681..5293
Strand+
Gene length (bp)1612
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 4.4E-169 15 485
PF06966 DUF1295 Protein of unknown function (DUF1295) 1.3E-04 308 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 1 485 0.0E+00
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 3 485 0.0E+00
sp|O13597|ERG24_SEPLY Delta(14)-sterol reductase OS=Septoria lycopersici GN=ERG3 PE=3 SV=1 9 485 0.0E+00
sp|P78575|ERG24_ASCIM Delta(14)-sterol reductase OS=Ascobolus immersus GN=ERG3 PE=3 SV=1 16 485 9.0E-131
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 5 485 1.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 1 485 0.0E+00
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 3 485 0.0E+00
sp|O13597|ERG24_SEPLY Delta(14)-sterol reductase OS=Septoria lycopersici GN=ERG3 PE=3 SV=1 9 485 0.0E+00
sp|P78575|ERG24_ASCIM Delta(14)-sterol reductase OS=Ascobolus immersus GN=ERG3 PE=3 SV=1 16 485 9.0E-131
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 5 485 1.0E-118
sp|Q3U9G9|LBR_MOUSE Lamin-B receptor OS=Mus musculus GN=Lbr PE=1 SV=2 10 485 2.0E-95
sp|Q5R7H4|LBR_PONAB Lamin-B receptor OS=Pongo abelii GN=LBR PE=2 SV=1 17 485 3.0E-94
sp|Q14739|LBR_HUMAN Lamin-B receptor OS=Homo sapiens GN=LBR PE=1 SV=2 17 485 4.0E-94
sp|O08984|LBR_RAT Lamin-B receptor OS=Rattus norvegicus GN=Lbr PE=1 SV=1 1 485 1.0E-93
sp|P32462|ERG24_YEAST Delta(14)-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG24 PE=1 SV=1 7 485 1.0E-93
sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus GN=LBR PE=1 SV=1 17 481 1.0E-89
sp|O76062|ERG24_HUMAN Delta(14)-sterol reductase OS=Homo sapiens GN=TM7SF2 PE=2 SV=3 100 485 3.0E-88
sp|Q71KT5|ERG24_MOUSE Delta(14)-sterol reductase OS=Mus musculus GN=Tm7sf2 PE=1 SV=2 100 485 4.0E-88
sp|Q8WMV1|ERG24_BOVIN Delta(14)-sterol reductase OS=Bos taurus GN=TM7SF2 PE=1 SV=1 100 485 9.0E-83
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 17 484 3.0E-66
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 38 485 6.0E-64
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 32 485 2.0E-62
sp|Q5E9J5|DHCR7_BOVIN 7-dehydrocholesterol reductase OS=Bos taurus GN=DHCR7 PE=2 SV=1 32 485 2.0E-61
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 32 485 4.0E-61
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 32 485 1.0E-60
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 32 485 3.0E-60
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 32 485 1.0E-59
sp|Q5UQI4|DHCR7_MIMIV Probable 7-dehydrocholesterol reductase OS=Acanthamoeba polyphaga mimivirus GN=DHCR7 PE=3 SV=1 108 485 2.0E-55
sp|Q9LDR4|ERG24_ARATH Delta(14)-sterol reductase OS=Arabidopsis thaliana GN=FK PE=1 SV=2 78 485 2.0E-54
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 74 485 8.0E-49
sp|P25340|ERG4_YEAST Delta(24(24(1)))-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG4 PE=1 SV=2 10 485 1.0E-40
sp|P36209|STS1_SCHPO Delta(24(24(1)))-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts1 PE=1 SV=2 1 485 8.0E-40
sp|Q8MLV1|LBR_DROME Lamin-B receptor OS=Drosophila melanogaster GN=LBR PE=1 SV=1 5 391 5.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 18 40 22
2 124 143 19
3 158 180 22
4 250 269 19
5 289 308 19
6 320 339 19
7 433 452 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5734
MPSSSKASASPAKHGYEFFGPPGAFGISFGLPLLVYVFALSCNDISGCPAPALLSPRTLSLSQLKLQVGWPGNGV
WGLASWQATGALLGYYALNLILYRLLPASEVDGTVLSSGGRLKYRCNTLYSNTVTLAALAAGTMAQGADFPVWTF
IDENYVQLLTASIGISYAISTFVYVRSFSVKPGDKQNRELAAGGHTGNLLYDWFIGRELNPRVTVPLIGELDIKE
WCELRPGMMGWIVLNCAWCARQYRNYGYVTDSILCITIVQAVYTVDSWWNESAILTTMDITTDGFGMMLAFGDLV
WVPFVYSLQTRYLSVHPRSLGPLGLLSMLTLIGLGFFIFRSANSQKNTFRTNPSDPSVSQLEYIETKTGSKLLTT
GWWGVARHINYFGDWIQSWPYSLPTGLAGYQILAAGSGAEGAYVMRDGREVVSGNAEGWGMLTTYFYVVYFAILL
IHRDRRDDEKCHRKYGEDWEKYKKIVRWRIIPGIY*
Coding >Hirsu2|5734
ATGCCTTCCAGCTCCAAAGCCTCCGCCTCCCCGGCCAAGCACGGCTACGAGTTCTTCGGCCCTCCTGGCGCGTTT
GGCATCTCGTTTGGCCTGCCCCTCCTCGTCTACGTCTTCGCCCTGTCCTGCAACGACATCTCTGGCTGTCCGGCT
CCGGCCCTGCTCAGCCCGCGAACCCTCTCGCTCAGCCAGCTGAAGCTTCAGGTTGGCTGGCCCGGGAATGGCGTC
TGGGGCCTCGCAAGCTGGCAGGCCACGGGGGCTTTGCTGGGCTACTACGCCCTCAACCTGATCCTCTACCGCCTC
CTCCCCGCAAGCGAAGTAGACGGCACCGTACTGTCTTCGGGCGGCCGCCTCAAGTACCGGTGCAATACCTTGTAC
TCCAACACCGTGACTCTCGCTGCCCTGGCCGCCGGTACCATGGCGCAGGGAGCCGACTTCCCTGTCTGGACCTTC
ATCGACGAGAACTATGTGCAGCTGCTAACTGCCAGCATTGGCATCTCCTACGCCATCTCCACCTTTGTCTATGTC
CGCAGCTTCAGCGTCAAGCCGGGAGACAAGCAGAACCGAGAGTTGGCGGCCGGCGGACACACCGGCAACCTGCTC
TACGATTGGTTCATCGGGCGCGAGCTTAACCCCCGCGTCACCGTGCCTCTGATCGGTGAGCTTGACATCAAGGAG
TGGTGCGAGCTGCGGCCCGGCATGATGGGCTGGATCGTCCTCAACTGCGCCTGGTGCGCCCGCCAGTACCGCAAC
TACGGCTACGTGACAGACAGCATCCTGTGCATCACCATCGTGCAGGCCGTCTACACCGTCGACTCGTGGTGGAAC
GAATCCGCCATTCTGACGACAATGGACATCACGACGGACGGATTTGGCATGATGCTGGCCTTTGGCGATCTCGTC
TGGGTTCCCTTCGTCTACTCGCTGCAGACGCGCTACCTCTCCGTCCACCCCCGATCGCTCGGTCCCCTGGGCCTG
CTGTCCATGCTGACGCTTATCGGCCTCGGCTTCTTCATCTTCCGCTCCGCCAACAGCCAGAAGAACACGTTCAGG
ACGAACCCGAGCGACCCGAGCGTCTCCCAACTCGAGTACATCGAGACCAAGACGGGAAGCAAGCTCCTCACGACG
GGATGGTGGGGGGTCGCCCGCCACATCAACTACTTCGGCGACTGGATCCAGTCGTGGCCGTACAGCCTGCCGACC
GGGCTGGCTGGCTACCAGATCCTCGCCGCCGGCTCGGGCGCCGAGGGCGCCTACGTGATGAGGGACGGCCGCGAG
GTTGTGTCGGGCAATGCAGAGGGCTGGGGCATGCTCACAACCTACTTTTACGTCGTCTACTTCGCCATTCTTCTC
ATCCACCGCGACCGCCGCGACGACGAAAAATGCCACCGCAAATACGGCGAGGATTGGGAAAAGTACAAGAAGATT
GTGCGGTGGCGCATCATCCCGGGCATCTACTAG
Transcript >Hirsu2|5734
ATGCCTTCCAGCTCCAAAGCCTCCGCCTCCCCGGCCAAGCACGGCTACGAGTTCTTCGGCCCTCCTGGCGCGTTT
GGCATCTCGTTTGGCCTGCCCCTCCTCGTCTACGTCTTCGCCCTGTCCTGCAACGACATCTCTGGCTGTCCGGCT
CCGGCCCTGCTCAGCCCGCGAACCCTCTCGCTCAGCCAGCTGAAGCTTCAGGTTGGCTGGCCCGGGAATGGCGTC
TGGGGCCTCGCAAGCTGGCAGGCCACGGGGGCTTTGCTGGGCTACTACGCCCTCAACCTGATCCTCTACCGCCTC
CTCCCCGCAAGCGAAGTAGACGGCACCGTACTGTCTTCGGGCGGCCGCCTCAAGTACCGGTGCAATACCTTGTAC
TCCAACACCGTGACTCTCGCTGCCCTGGCCGCCGGTACCATGGCGCAGGGAGCCGACTTCCCTGTCTGGACCTTC
ATCGACGAGAACTATGTGCAGCTGCTAACTGCCAGCATTGGCATCTCCTACGCCATCTCCACCTTTGTCTATGTC
CGCAGCTTCAGCGTCAAGCCGGGAGACAAGCAGAACCGAGAGTTGGCGGCCGGCGGACACACCGGCAACCTGCTC
TACGATTGGTTCATCGGGCGCGAGCTTAACCCCCGCGTCACCGTGCCTCTGATCGGTGAGCTTGACATCAAGGAG
TGGTGCGAGCTGCGGCCCGGCATGATGGGCTGGATCGTCCTCAACTGCGCCTGGTGCGCCCGCCAGTACCGCAAC
TACGGCTACGTGACAGACAGCATCCTGTGCATCACCATCGTGCAGGCCGTCTACACCGTCGACTCGTGGTGGAAC
GAATCCGCCATTCTGACGACAATGGACATCACGACGGACGGATTTGGCATGATGCTGGCCTTTGGCGATCTCGTC
TGGGTTCCCTTCGTCTACTCGCTGCAGACGCGCTACCTCTCCGTCCACCCCCGATCGCTCGGTCCCCTGGGCCTG
CTGTCCATGCTGACGCTTATCGGCCTCGGCTTCTTCATCTTCCGCTCCGCCAACAGCCAGAAGAACACGTTCAGG
ACGAACCCGAGCGACCCGAGCGTCTCCCAACTCGAGTACATCGAGACCAAGACGGGAAGCAAGCTCCTCACGACG
GGATGGTGGGGGGTCGCCCGCCACATCAACTACTTCGGCGACTGGATCCAGTCGTGGCCGTACAGCCTGCCGACC
GGGCTGGCTGGCTACCAGATCCTCGCCGCCGGCTCGGGCGCCGAGGGCGCCTACGTGATGAGGGACGGCCGCGAG
GTTGTGTCGGGCAATGCAGAGGGCTGGGGCATGCTCACAACCTACTTTTACGTCGTCTACTTCGCCATTCTTCTC
ATCCACCGCGACCGCCGCGACGACGAAAAATGCCACCGCAAATACGGCGAGGATTGGGAAAAGTACAAGAAGATT
GTGCGGTGGCGCATCATCCCGGGCATCTACTAG
Gene >Hirsu2|5734
ATGCCTTCCAGCTCCAAAGCCTCCGCCTCCCCGGCCAAGCACGGCTACGAGTTCTTCGGCCCGTAAGTCGTCCCG
ACTCTGCTGGCATCTTATCGCGTCTTCCTGGCTGTTCGTCATCATCGAAGCAGCTTGCTGACCAGCTGCTCGCCT
CAAAGTCCTGGCGCGTTTGGCATCTCGTTTGGCCTGCCCCTCCTCGTCTACGTCTTCGCCCTGTCCTGCAACGAC
ATCTCTGGCTGTCCGGCTCCGGCCCTGCTCAGCCCGCGAACCCTCTCGCTCAGCCAGCTGAAGCTTCAGGTTGGC
TGGCCCGGGAATGGCGTCTGGGGCCTCGCAAGCTGGCAGGCCACGGGGGCTTTGCTGGGCTACTACGCCCTCAAC
CTGATCCTCTACCGCCTCCTCCCCGCAAGCGAAGTAGACGGCACCGTACTGTCTTCGGGCGGCCGCCTCAAGTAC
CGGTGCAATAGTGAGTAGCTCCCCCGTCGGGCCCCTCGTCGGTACTGCGTCCTGACCGACTCTCATCGCAGCCTT
GTACTCCAACACCGTGACTCTCGCTGCCCTGGCCGCCGGTACCATGGCGCAGGGAGCCGACTTCCCTGTCTGGAC
CTTCATCGACGAGAACTATGTGCAGCTGCTAACTGCCAGCATTGGCATCTCCTACGCCATCTCCACCTTTGTCTA
TGTCCGCAGCTTCAGCGTCAAGCCGGGAGACAAGCAGAACCGAGAGTTGGCGGCCGGCGGACACACCGGCAACCT
GCTCTACGATTGGTTCATCGGGCGCGAGCTTAACCCCCGCGTCACCGTGCCTCTGATCGGTGAGCTTGACATCAA
GGAGTGGTGCGAGCTGCGGCCCGGCATGATGGGCTGGATCGTCCTCAACTGCGCCTGGTGCGCCCGCCAGTACCG
CAACTACGGCTACGTGACAGACAGCATCCTGTGCATCACCATCGTGCAGGCCGTCTACACCGTCGACTCGTGGTG
GAACGAATCCGCCATTCTGACGACAATGGACATCACGACGGACGGATTTGGCATGATGCTGGCCTTTGGCGATCT
CGTCTGGGTTCCCTTCGTCTACTCGCTGCAGACGCGCTACCTCTCCGTCCACCCCCGATCGCTCGGTCCCCTGGG
CCTGCTGTCCATGCTGACGCTTATCGGCCTCGGCTTCTTCATCTTCCGCTCCGCCAACAGCCAGAAGAACACGTT
CAGGACGAACCCGAGCGACCCGAGCGTCTCCCAACTCGAGTACATCGAGACCAAGACGGGAAGCAAGCTCCTCAC
GACGGGATGGTGGGGGGTCGCCCGCCACATCAACTACTTCGGCGACTGGATCCAGTCGTGGCCGTACAGCCTGCC
GACCGGGCTGGCTGGCTACCAGATCCTCGCCGCCGGCTCGGGCGCCGAGGGCGCCTACGTGATGAGGGACGGCCG
CGAGGTTGTGTCGGGCAATGCAGAGGGCTGGGGCATGCTCACAACCTACTTTTACGTCGTCTACTTCGCCATTCT
TCTCATCCACCGCGACCGCCGCGACGACGAAAAATGCCACCGCAAATACGGCGAGGATTGGGAAAAGTACAAGAA
GATTGTGCGGTGGCGCATCATCCCGGGCATCTACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail