Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5733
Gene name
LocationContig_289:1672..2871
Strand-
Gene length (bp)1199
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02157 Man-6-P_recep Mannose-6-phosphate receptor 1.6E-14 185 295
PF09451 ATG27 Autophagy-related protein 27 5.1E-12 185 299
PF00878 CIMR Cation-independent mannose-6-phosphate receptor repeat 3.9E-05 189 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59745|YN29_SCHPO Putative mannose 6-phosphate receptor-like protein C530.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.09c PE=3 SV=1 31 296 2.0E-35
sp|Q75BD5|MRL1_ASHGO Mannose 6-phosphate receptor-like protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRL1 PE=3 SV=1 31 339 1.0E-11
sp|P24668|MPRD_MOUSE Cation-dependent mannose-6-phosphate receptor OS=Mus musculus GN=M6pr PE=1 SV=1 219 295 8.0E-08
sp|Q6AY20|MPRD_RAT Cation-dependent mannose-6-phosphate receptor OS=Rattus norvegicus GN=M6pr PE=1 SV=1 219 295 9.0E-08
sp|P11456|MPRD_BOVIN Cation-dependent mannose-6-phosphate receptor OS=Bos taurus GN=M6PR PE=1 SV=1 219 295 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59745|YN29_SCHPO Putative mannose 6-phosphate receptor-like protein C530.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.09c PE=3 SV=1 31 296 2.0E-35
sp|Q75BD5|MRL1_ASHGO Mannose 6-phosphate receptor-like protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRL1 PE=3 SV=1 31 339 1.0E-11
sp|P24668|MPRD_MOUSE Cation-dependent mannose-6-phosphate receptor OS=Mus musculus GN=M6pr PE=1 SV=1 219 295 8.0E-08
sp|Q6AY20|MPRD_RAT Cation-dependent mannose-6-phosphate receptor OS=Rattus norvegicus GN=M6pr PE=1 SV=1 219 295 9.0E-08
sp|P11456|MPRD_BOVIN Cation-dependent mannose-6-phosphate receptor OS=Bos taurus GN=M6PR PE=1 SV=1 219 295 1.0E-07
sp|P20645|MPRD_HUMAN Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens GN=M6PR PE=1 SV=1 219 295 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0038023 signaling receptor activity Yes
GO:0051219 phosphoprotein binding Yes
GO:0007041 lysosomal transport Yes
GO:0007034 vacuolar transport No
GO:0005515 protein binding No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0060089 molecular transducer activity No
GO:0051234 establishment of localization No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 246 268 22
2 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5733
MRFPLAAALLAAGAVAGAADKDAPSSTTPVPACTATSSTGSGAFFDLRPDMAAVKEQSPKSAVSKDYRARGYDYG
KNFTLNICGAVVDPVTDVVGLKKDLWANVSAYYMSHGNIYSIGSESMDLRSRGRKLVLQYGGGSPCGGKSSSKDR
RAADDNQPRPRDGRSAPSSLSPRSQTVTARDDKEKATVKRKSTTISFLCDRDPGNTQASVSFVGTDPDECAYFFE
ARSVHACAHAEPHKPGSVGPGSVFGLILLIAVLVYVLGGVFYNRTVTNARGWRQLPNYSLWAGIGGFISDVFFNA
WAWCSRCLPSRRGYRYLNSNASSRHQNSDAENRLIDQLDEEWDD*
Coding >Hirsu2|5733
ATGCGCTTCCCTCTCGCTGCGGCTCTACTCGCTGCCGGCGCAGTGGCCGGCGCAGCAGACAAAGATGCGCCGTCG
TCAACAACGCCGGTGCCGGCATGCACTGCCACCTCGTCCACCGGCAGCGGTGCCTTTTTCGATCTGCGGCCGGAC
ATGGCGGCCGTCAAGGAGCAATCGCCCAAGTCGGCCGTATCCAAAGACTACCGGGCCAGAGGGTACGACTACGGG
AAAAACTTCACCTTGAACATCTGTGGGGCCGTCGTGGATCCCGTCACGGACGTCGTTGGCTTGAAGAAGGATCTG
TGGGCCAACGTGAGCGCATACTACATGTCTCACGGGAACATTTATTCTATAGGGTCCGAGTCGATGGATCTACGC
AGTCGTGGGCGAAAGCTTGTGCTGCAGTACGGAGGCGGCTCTCCCTGCGGCGGCAAGTCGTCGTCCAAGGACAGA
CGGGCTGCCGATGACAATCAGCCTCGTCCTCGTGATGGCCGATCCGCGCCGTCTTCCCTGTCCCCGCGGTCCCAG
ACCGTCACGGCCAGGGACGACAAGGAAAAGGCGACAGTCAAGCGAAAGTCGACGACGATTTCCTTCCTCTGCGAC
CGCGACCCGGGCAACACGCAGGCCAGCGTGTCCTTCGTCGGCACCGACCCGGACGAATGCGCCTACTTCTTCGAG
GCTCGCTCCGTCCACGCCTGCGCCCACGCGGAGCCGCACAAGCCGGGCAGCGTCGGCCCGGGCAGCGTGTTTGGA
CTGATCCTGCTCATCGCCGTGCTCGTCTACGTGCTGGGGGGCGTCTTTTACAACCGCACGGTGACGAACGCTCGA
GGCTGGCGGCAGCTGCCCAACTACAGCCTGTGGGCCGGCATCGGGGGCTTCATCAGCGACGTCTTCTTCAACGCC
TGGGCTTGGTGCTCGCGCTGCCTGCCGAGCAGGCGAGGCTACCGCTACCTCAACTCCAACGCGAGCAGCCGACAC
CAAAACTCGGACGCGGAGAACCGGCTGATAGATCAGCTGGACGAGGAATGGGACGACTAG
Transcript >Hirsu2|5733
ATGCGCTTCCCTCTCGCTGCGGCTCTACTCGCTGCCGGCGCAGTGGCCGGCGCAGCAGACAAAGATGCGCCGTCG
TCAACAACGCCGGTGCCGGCATGCACTGCCACCTCGTCCACCGGCAGCGGTGCCTTTTTCGATCTGCGGCCGGAC
ATGGCGGCCGTCAAGGAGCAATCGCCCAAGTCGGCCGTATCCAAAGACTACCGGGCCAGAGGGTACGACTACGGG
AAAAACTTCACCTTGAACATCTGTGGGGCCGTCGTGGATCCCGTCACGGACGTCGTTGGCTTGAAGAAGGATCTG
TGGGCCAACGTGAGCGCATACTACATGTCTCACGGGAACATTTATTCTATAGGGTCCGAGTCGATGGATCTACGC
AGTCGTGGGCGAAAGCTTGTGCTGCAGTACGGAGGCGGCTCTCCCTGCGGCGGCAAGTCGTCGTCCAAGGACAGA
CGGGCTGCCGATGACAATCAGCCTCGTCCTCGTGATGGCCGATCCGCGCCGTCTTCCCTGTCCCCGCGGTCCCAG
ACCGTCACGGCCAGGGACGACAAGGAAAAGGCGACAGTCAAGCGAAAGTCGACGACGATTTCCTTCCTCTGCGAC
CGCGACCCGGGCAACACGCAGGCCAGCGTGTCCTTCGTCGGCACCGACCCGGACGAATGCGCCTACTTCTTCGAG
GCTCGCTCCGTCCACGCCTGCGCCCACGCGGAGCCGCACAAGCCGGGCAGCGTCGGCCCGGGCAGCGTGTTTGGA
CTGATCCTGCTCATCGCCGTGCTCGTCTACGTGCTGGGGGGCGTCTTTTACAACCGCACGGTGACGAACGCTCGA
GGCTGGCGGCAGCTGCCCAACTACAGCCTGTGGGCCGGCATCGGGGGCTTCATCAGCGACGTCTTCTTCAACGCC
TGGGCTTGGTGCTCGCGCTGCCTGCCGAGCAGGCGAGGCTACCGCTACCTCAACTCCAACGCGAGCAGCCGACAC
CAAAACTCGGACGCGGAGAACCGGCTGATAGATCAGCTGGACGAGGAATGGGACGACTAG
Gene >Hirsu2|5733
ATGCGCTTCCCTCTCGCTGCGGCTCTACTCGCTGCCGGCGCAGTGGCCGGCGCAGCAGACAAAGATGCGCCGTCG
TCAACAACGCCGGTGCCGGCATGCACTGCCACCTCGTCCACCGGCAGCGGTGCCTTTTTCGATCTGCGGCCGGAC
ATGGCGGCCGTCAAGGAGCAATCGCCCAAGTCGGCCGTATCCAAAGACTACCGGGCCAGAGGGTACGACTACGGG
AAAAACTTCACCTTGAACATCTGTGGGGCCGTCGTGGATCCCGTCACGGACGTCGTTGGCTTGAAGAAGGATCTG
TGGGCCAACGTGAGCGCATACTACATGTCTCACGGGAACATTTATTCTATAGGGTGAGGATGGCCCCGTTGTCGA
CAGCTCGTCGCCGCCCTCGTTCATTCTGCAGATGCGCGCGTCAGACACTGACGTTACCGAAATCCAGGTCCGAGT
CGATGGATCTACGCAGTCGTGGGCGAAAGCTTGTGCTGCAGTACGGAGGCGGCTCTCCCTGCGGCGGCAAGTCGT
CGTCCAAGGACAGACGGGCTGCCGATGACAATCAGCCTCGTCCTCGTGATGGCCGATCCGCGCCGTCTTCCCTGT
CCCCGCGGTCCCAGACCGTCACGGCCAGGGACGACAAGGAAAAGGCGACAGTCAAGCGAAAGTCGACGACGATTT
CCTTCCTCTGCGACCGCGACCCGGGCAACACGCAGGCCAGCGTGTCCTTCGTCGGCACCGACCCGGACGAATGCG
CCTACTTCTTCGAGGCTCGCTCCGTCCACGCCTGCGCCCACGCGGAGCCGCACAAGCCGGGCAGCGTCGGCCCGG
GCAGCGTGTTTGGACTGATCCTGCTCATCGCCGTGCTCGTCTACGTGCTGGGGGGCGTCTTTTACAACCGCACGG
TGACGAACGCTCGAGGCTGGCGGCAGCTGCCCAACTACAGCCTGTGGGCCGGCATCGGGGGCTTCATCAGCGTGC
GTCCCTCTCGTCTCAAGGCGGATCTGCCTCTCCACCGACGTGCGGGCTGACCCGTTTGCTTTGGCGCGTAGGACG
TCTTCTTCAACGCCTGGGCTTGGTGCTCGCGCTGCCTGCCGAGCAGGCGAGGCTACCGCTACCTCAACTCCAACG
CGAGCAGCCGACACCAAAACTCGGACGCGGAGAACCGGCTGATAGATCAGCTGGACGAGGAATGGGACGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail