Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5724
Gene name
LocationContig_2883:80..1118
Strand+
Gene length (bp)1038
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09273 Rubis-subs-bind Rubisco LSMT substrate-binding 2.1E-19 73 194
PF01753 zf-MYND MYND finger 1.2E-06 216 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E2RBS6|SETD3_CANLF Histone-lysine N-methyltransferase setd3 OS=Canis lupus familiaris GN=SETD3 PE=3 SV=1 6 201 3.0E-13
sp|B0VX69|SETD3_CALJA Histone-lysine N-methyltransferase setd3 OS=Callithrix jacchus GN=SETD3 PE=3 SV=2 6 201 3.0E-13
sp|B1MTJ4|SETD3_CALMO Histone-lysine N-methyltransferase setd3 OS=Callicebus moloch GN=SETD3 PE=3 SV=2 6 201 3.0E-13
sp|B2KI88|SETD3_RHIFE Histone-lysine N-methyltransferase setd3 OS=Rhinolophus ferrumequinum GN=SETD3 PE=3 SV=1 6 201 6.0E-13
sp|C1FXW2|SETD3_DASNO Histone-lysine N-methyltransferase setd3 OS=Dasypus novemcinctus GN=SETD3 PE=3 SV=1 6 201 8.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E2RBS6|SETD3_CANLF Histone-lysine N-methyltransferase setd3 OS=Canis lupus familiaris GN=SETD3 PE=3 SV=1 6 201 3.0E-13
sp|B0VX69|SETD3_CALJA Histone-lysine N-methyltransferase setd3 OS=Callithrix jacchus GN=SETD3 PE=3 SV=2 6 201 3.0E-13
sp|B1MTJ4|SETD3_CALMO Histone-lysine N-methyltransferase setd3 OS=Callicebus moloch GN=SETD3 PE=3 SV=2 6 201 3.0E-13
sp|B2KI88|SETD3_RHIFE Histone-lysine N-methyltransferase setd3 OS=Rhinolophus ferrumequinum GN=SETD3 PE=3 SV=1 6 201 6.0E-13
sp|C1FXW2|SETD3_DASNO Histone-lysine N-methyltransferase setd3 OS=Dasypus novemcinctus GN=SETD3 PE=3 SV=1 6 201 8.0E-13
sp|A9X1D0|SETD3_PAPAN Histone-lysine N-methyltransferase setd3 OS=Papio anubis GN=SETD3 PE=3 SV=1 6 201 9.0E-13
sp|B5FW36|SETD3_OTOGA Histone-lysine N-methyltransferase setd3 OS=Otolemur garnettii GN=SETD3 PE=3 SV=1 6 201 2.0E-12
sp|Q91WC0|SETD3_MOUSE Histone-lysine N-methyltransferase setd3 OS=Mus musculus GN=Setd3 PE=1 SV=1 6 201 2.0E-12
sp|Q86TU7|SETD3_HUMAN Histone-lysine N-methyltransferase setd3 OS=Homo sapiens GN=SETD3 PE=1 SV=1 6 201 4.0E-12
sp|Q7SXS7|SETD3_DANRE Histone-lysine N-methyltransferase setd3 OS=Danio rerio GN=setd3 PE=1 SV=1 6 197 4.0E-11
sp|Q5ZML9|SETD3_CHICK Histone-lysine N-methyltransferase setd3 OS=Gallus gallus GN=SETD3 PE=2 SV=1 6 215 1.0E-10
sp|B7ZUF3|SETD3_XENTR Histone-lysine N-methyltransferase setd3 OS=Xenopus tropicalis GN=setd3 PE=2 SV=1 6 163 1.0E-09
sp|Q5FWU8|ZMY10_XENLA Zinc finger MYND domain-containing protein 10 OS=Xenopus laevis GN=zmynd10 PE=2 SV=1 187 254 6.0E-07
sp|Q6NQJ8|SDG40_ARATH Protein SET DOMAIN GROUP 40 OS=Arabidopsis thaliana GN=SDG40 PE=2 SV=1 23 155 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5724
MDDYKWALCSCHAYDPKSGDLSILAAKDYQVGDQVFISYGSVPNNRLLRLYGFVLPDNPNDSYDLVLQTSPVAPL
YEQKERLWALAGLSSTCTISLTVKDPPPNSVLRYLRIQRLDESNITDMTLQLANGTDGKVSIENEMQVLHFLVDS
IGILLESFVIPLEKLEARLTGQDYPAGGNAWAAAQVSAGEQRILTWAKKWAENLLEAISRPPATKCANCGNRSNA
LMSCGRRKAVKYCKRQCQVAHFKDHRAACRTHAGLK*
Coding >Hirsu2|5724
ATGGACGATTACAAATGGGCTCTTTGCTCATGCCATGCTTACGATCCAAAGTCTGGAGACCTCTCCATCCTTGCT
GCGAAGGACTACCAAGTCGGAGATCAGGTATTCATATCCTACGGTAGCGTGCCGAACAACCGACTTCTGCGTCTA
TACGGCTTTGTTCTGCCGGACAACCCCAACGACAGTTACGACCTCGTGCTCCAGACAAGCCCGGTGGCCCCTCTC
TACGAGCAGAAGGAAAGGCTCTGGGCGCTGGCAGGGCTCAGCTCAACATGCACTATTTCTCTCACTGTGAAGGAT
CCGCCTCCGAACAGCGTGCTTCGATACCTCCGAATCCAGCGACTGGACGAATCCAACATCACAGACATGACTCTG
CAGCTAGCGAATGGCACAGACGGCAAGGTCAGCATTGAAAACGAGATGCAGGTGTTGCACTTTTTGGTAGATTCG
ATAGGCATCCTCCTGGAGAGCTTCGTCATCCCGCTGGAAAAGCTCGAGGCGAGGCTCACCGGGCAAGACTACCCC
GCTGGGGGCAACGCTTGGGCAGCGGCACAGGTCAGTGCCGGCGAGCAGCGAATCTTGACGTGGGCCAAGAAGTGG
GCCGAAAATCTGCTGGAGGCGATTTCTCGTCCACCAGCGACAAAGTGCGCCAACTGCGGGAACAGGTCTAATGCG
TTGATGTCGTGCGGCAGACGCAAGGCCGTCAAGTACTGCAAGAGGCAGTGTCAGGTGGCGCACTTTAAAGACCAC
AGGGCCGCGTGCCGGACTCATGCGGGATTGAAATGA
Transcript >Hirsu2|5724
ATGGACGATTACAAATGGGCTCTTTGCTCATGCCATGCTTACGATCCAAAGTCTGGAGACCTCTCCATCCTTGCT
GCGAAGGACTACCAAGTCGGAGATCAGGTATTCATATCCTACGGTAGCGTGCCGAACAACCGACTTCTGCGTCTA
TACGGCTTTGTTCTGCCGGACAACCCCAACGACAGTTACGACCTCGTGCTCCAGACAAGCCCGGTGGCCCCTCTC
TACGAGCAGAAGGAAAGGCTCTGGGCGCTGGCAGGGCTCAGCTCAACATGCACTATTTCTCTCACTGTGAAGGAT
CCGCCTCCGAACAGCGTGCTTCGATACCTCCGAATCCAGCGACTGGACGAATCCAACATCACAGACATGACTCTG
CAGCTAGCGAATGGCACAGACGGCAAGGTCAGCATTGAAAACGAGATGCAGGTGTTGCACTTTTTGGTAGATTCG
ATAGGCATCCTCCTGGAGAGCTTCGTCATCCCGCTGGAAAAGCTCGAGGCGAGGCTCACCGGGCAAGACTACCCC
GCTGGGGGCAACGCTTGGGCAGCGGCACAGGTCAGTGCCGGCGAGCAGCGAATCTTGACGTGGGCCAAGAAGTGG
GCCGAAAATCTGCTGGAGGCGATTTCTCGTCCACCAGCGACAAAGTGCGCCAACTGCGGGAACAGGTCTAATGCG
TTGATGTCGTGCGGCAGACGCAAGGCCGTCAAGTACTGCAAGAGGCAGTGTCAGGTGGCGCACTTTAAAGACCAC
AGGGCCGCGTGCCGGACTCATGCGGGATTGAAATGA
Gene >Hirsu2|5724
ATGGACGATGTGAGTTTCGTCGCCTCCTGTCGCATCCCGTTGTCGTTCCCGGTCGCCTACGAGCTTACCCTTACG
TTATTAGTACAAATGGGCTCTTTGCTCAGTATGGAGTCGTGCAATGGACTTTGCAGTCCCAGAAACGACTTCGGT
TCGGCTCGTGGCCCTCTGGCAGACATGCTAAATCATTCTCTCGACGCAAAGCAGTGCCATGCTTACGATCCAAAG
TCTGGAGACCTCTCCATCCTTGCTGCGAAGGACTACCAAGTCGGAGATCAGGTTTGCCCATCACCCTGCGAATCT
CTGTCGATGCGCAATTTTTTTTTCCAGATAGCTGACCCGATGTTAAAATGATAGGTATTCATATCCTACGGTAGC
GTGCCGAACAACCGACTTCTGCGTCTATACGGCTTTGTTCTGCCGGACAACCCCAACGACAGTTACGACCTCGTG
CTCCAGACAAGCCCGGTGGCCCCTCTCTACGAGCAGAAGGAAAGGCTCTGGGCGCTGGCAGGGCTCAGCTCAACA
TGCACTATTTCTCTCACTGTGAAGGATCCGCCTCCGAACAGCGTGCTTCGATACCTCCGAATCCAGCGACTGGAC
GAATCCAACATCACAGACATGACTCTGCAGCTAGCGAATGGCACAGACGGCAAGGTCAGCATTGAAAACGAGATG
CAGGTGTTGCACTTTTTGGTAGATTCGATAGGCATCCTCCTGGAGAGCTTCGTCATCCCGCTGGAAAAGCTCGAG
GCGAGGCTCACCGGGCAAGACTACCCCGCTGGGGGCAACGCTTGGGCAGCGGCACAGGTCAGTGCCGGCGAGCAG
CGAATCTTGACGTGGGCCAAGAAGTGGGCCGAAAATCTGCTGGAGGCGATTTCTCGTCCACCAGCGACAAAGTGC
GCCAACTGCGGGAACAGGTCTAATGCGTTGATGTCGTGCGGCAGACGCAAGGCCGTCAAGTACTGCAAGAGGCAG
TGTCAGGTGGCGCACTTTAAAGACCACAGGGCCGCGTGCCGGACTCATGCGGGATTGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail