Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5722
Gene name
LocationContig_2880:793..1542
Strand-
Gene length (bp)749
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03896 TRAP_alpha Translocon-associated protein (TRAP), alpha subunit 3.5E-06 48 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 7 199 3.0E-15
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 8 207 4.0E-15
sp|Q6BW93|IRC22_DEBHA Increased recombination centers protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IRC22 PE=3 SV=1 5 205 4.0E-12
sp|C4YKP5|IR221_CANAW Increased recombination centers protein 22-1 OS=Candida albicans (strain WO-1) GN=IRC22-1 PE=3 SV=1 8 207 7.0E-12
sp|Q59YF4|IR221_CANAL Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1 8 207 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 7 199 3.0E-15
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 8 207 4.0E-15
sp|Q6BW93|IRC22_DEBHA Increased recombination centers protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IRC22 PE=3 SV=1 5 205 4.0E-12
sp|C4YKP5|IR221_CANAW Increased recombination centers protein 22-1 OS=Candida albicans (strain WO-1) GN=IRC22-1 PE=3 SV=1 8 207 7.0E-12
sp|Q59YF4|IR221_CANAL Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1 8 207 2.0E-11
sp|P0CH79|IR222_CANAW Increased recombination centers protein 22-2 OS=Candida albicans (strain WO-1) GN=IRC22-2 PE=3 SV=1 8 207 4.0E-11
sp|Q59XW9|IR222_CANAL Increased recombination centers protein 22-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-2 PE=3 SV=1 8 207 1.0E-10
sp|A5DYV2|IRC22_LODEL Increased recombination centers protein 22 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IRC22 PE=3 SV=1 8 206 5.0E-10
sp|A3LU17|IRC22_PICST Increased recombination centers protein 22 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IRC22 PE=3 SV=1 8 205 4.0E-06
sp|C5M580|IR221_CANTT Increased recombination centers protein 22-1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-1 PE=3 SV=1 7 199 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0044446 intracellular organelle part No
GO:0044432 endoplasmic reticulum part No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044424 intracellular part No
GO:0016020 membrane No
GO:0044422 organelle part No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5722
LLGVRLINGQPTKAIVEVTNREAGPITVALLAGSLARVKELPAGAPAYRGILRNLTAVQYNLVIEAGESKALPFS
FVQDMQPQEVRLQIIAVVTTDKGIVQVPAHNGTAVIVEAPTGFFDLQIIFLYLVLSAAFAGTLYFVYKTWIEALF
PQAKRTKTPKKGKKVLDADAALSGSESAGVSTGASKTYDESWIPDHHIKPPVAKRVKSGTGGKKKNLD*
Coding >Hirsu2|5722
CTGCTGGGCGTCCGGCTCATCAACGGCCAGCCGACCAAGGCCATCGTCGAGGTGACGAACCGCGAGGCCGGCCCC
ATCACCGTCGCCCTCCTGGCCGGCTCCCTCGCCCGCGTCAAGGAGCTGCCGGCCGGCGCCCCCGCCTACCGCGGC
ATCCTCCGCAACCTGACCGCCGTCCAGTACAACCTGGTCATCGAGGCCGGCGAGTCCAAGGCCCTGCCCTTCTCC
TTCGTCCAGGACATGCAGCCGCAGGAGGTCCGTCTCCAGATCATCGCCGTCGTCACCACCGACAAGGGAATCGTC
CAGGTGCCTGCCCACAACGGCACCGCCGTCATCGTCGAGGCCCCCACCGGCTTCTTCGATCTGCAAATCATCTTC
CTCTACCTCGTCCTCTCCGCCGCCTTCGCCGGCACCCTCTACTTCGTCTACAAGACCTGGATCGAGGCCCTCTTC
CCCCAGGCCAAGCGCACCAAGACGCCCAAGAAGGGCAAGAAGGTCCTCGACGCCGACGCCGCACTCTCCGGCTCC
GAGTCGGCCGGCGTGTCGACGGGCGCCAGCAAGACGTACGACGAGAGCTGGATTCCCGACCACCACATCAAGCCT
CCCGTCGCCAAGCGCGTCAAGTCGGGCACCGGCGGCAAGAAGAAGAACCTGGACTGA
Transcript >Hirsu2|5722
CTGCTGGGCGTCCGGCTCATCAACGGCCAGCCGACCAAGGCCATCGTCGAGGTGACGAACCGCGAGGCCGGCCCC
ATCACCGTCGCCCTCCTGGCCGGCTCCCTCGCCCGCGTCAAGGAGCTGCCGGCCGGCGCCCCCGCCTACCGCGGC
ATCCTCCGCAACCTGACCGCCGTCCAGTACAACCTGGTCATCGAGGCCGGCGAGTCCAAGGCCCTGCCCTTCTCC
TTCGTCCAGGACATGCAGCCGCAGGAGGTCCGTCTCCAGATCATCGCCGTCGTCACCACCGACAAGGGAATCGTC
CAGGTGCCTGCCCACAACGGCACCGCCGTCATCGTCGAGGCCCCCACCGGCTTCTTCGATCTGCAAATCATCTTC
CTCTACCTCGTCCTCTCCGCCGCCTTCGCCGGCACCCTCTACTTCGTCTACAAGACCTGGATCGAGGCCCTCTTC
CCCCAGGCCAAGCGCACCAAGACGCCCAAGAAGGGCAAGAAGGTCCTCGACGCCGACGCCGCACTCTCCGGCTCC
GAGTCGGCCGGCGTGTCGACGGGCGCCAGCAAGACGTACGACGAGAGCTGGATTCCCGACCACCACATCAAGCCT
CCCGTCGCCAAGCGCGTCAAGTCGGGCACCGGCGGCAAGAAGAAGAACCTGGACTGA
Gene >Hirsu2|5722
CTGCTGGGCGTCCGGCTCATCAACGGCCAGCCGACCAAGGCCATCGTCGAGGTGACGAACCGCGAGGCCGGCCCC
ATCACCGTCGCCCTCCTGGCCGGCTCCCTCGCCCGCGTCAAGGAGCTGCCGGCCGGCGCCCCCGCCTACCGCGGC
ATCCTCCGCAACCTGACCGCCGTCCAGTACAACCTGGTCATCGAGGCCGGCGAGTCCAAGGCCCTGCCCTTCTCC
TTCGTCCAGGACATGCAGCCGCAGGAGGTCCGTCTCCAGATCATCGCCGTCGTCACCACCGACAAGGGAATCGTC
CAGGTGCCTGCCCACAACGGCACCGCCGTCATCGTCGAGGCCCCCACCGGCTTCTTCGATCTGCAAATGTACGTC
CCTACTTTTCCTCCTCACAGAGAGCCTCTTGCCGAGGGGGTGAAGAAATTGACGTCGAGTGCCTTATCCCCTGAC
CGTCGCGCAGCATCTTCCTCTACCTCGTCCTCTCCGCCGCCTTCGCCGGCACCCTCTACTTCGTCTACAAGACCT
GGATCGAGGCCCTCTTCCCCCAGGCCAAGCGCACCAAGACGCCCAAGAAGGGCAAGAAGGTCCTCGACGCCGACG
CCGCACTCTCCGGCTCCGAGTCGGCCGGCGTGTCGACGGGCGCCAGCAAGACGTACGACGAGAGCTGGATTCCCG
ACCACCACATCAAGCCTCCCGTCGCCAAGCGCGTCAAGTCGGGCACCGGCGGCAAGAAGAAGAACCTGGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail