Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5719
Gene name
LocationContig_288:8760..11415
Strand+
Gene length (bp)2655
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08232 Striatin Striatin family 3.0E-41 32 169
PF00400 WD40 WD domain, G-beta repeat 2.1E-02 443 487
PF00400 WD40 WD domain, G-beta repeat 7.8E-04 495 546
PF00400 WD40 WD domain, G-beta repeat 8.4E-04 730 768
PF00400 WD40 WD domain, G-beta repeat 8.4E-05 773 813

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70M86|STRN_SORMK Striatin Pro11 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=pro11 PE=3 SV=1 11 815 0.0E+00
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 365 814 1.0E-34
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 365 814 2.0E-34
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 365 814 2.0E-34
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 365 814 4.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70M86|STRN_SORMK Striatin Pro11 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=pro11 PE=3 SV=1 11 815 0.0E+00
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 365 814 1.0E-34
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 365 814 2.0E-34
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 365 814 2.0E-34
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 365 814 4.0E-34
sp|Q54J37|STRN_DICDI Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 376 813 5.0E-30
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 365 814 2.0E-28
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 714 814 7.0E-20
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 714 814 8.0E-20
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 714 814 8.0E-20
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 694 814 6.0E-19
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 372 791 5.0E-17
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 411 813 3.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 380 813 6.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 372 814 4.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 423 813 8.0E-13
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 457 813 1.0E-12
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 455 813 3.0E-12
sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 376 813 6.0E-12
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 475 813 1.0E-11
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 457 813 1.0E-11
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 457 813 1.0E-11
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 457 813 1.0E-11
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 443 814 1.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 382 813 1.0E-11
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 457 813 1.0E-11
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 457 813 1.0E-11
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 457 813 1.0E-11
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 473 813 3.0E-11
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 475 813 4.0E-11
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 361 548 7.0E-11
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 457 813 7.0E-11
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 361 554 8.0E-11
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 361 554 1.0E-10
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 447 813 2.0E-10
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 475 813 2.0E-10
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 457 813 3.0E-10
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 457 813 3.0E-10
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 457 813 3.0E-10
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 457 813 4.0E-10
sp|Q05040|FAR8_YEAST Factor arrest protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR8 PE=1 SV=1 31 119 5.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 370 813 5.0E-10
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 475 813 8.0E-10
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 475 813 8.0E-10
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 713 781 9.0E-10
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 475 813 1.0E-09
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 475 813 2.0E-09
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 475 782 3.0E-09
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 713 813 3.0E-09
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 475 813 3.0E-09
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 30 99 4.0E-09
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 714 813 4.0E-09
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 714 813 4.0E-09
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 475 813 4.0E-09
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 713 813 4.0E-09
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 30 99 5.0E-09
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 30 99 5.0E-09
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 30 99 5.0E-09
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 475 813 6.0E-09
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 30 99 7.0E-09
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 30 99 8.0E-09
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 30 99 8.0E-09
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 475 813 9.0E-09
sp|O94560|YGD1_SCHPO Uncharacterized WD repeat-containing protein C1773.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.01 PE=3 SV=1 31 174 1.0E-08
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 475 813 1.0E-08
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 475 813 1.0E-08
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 475 813 1.0E-08
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 475 813 1.0E-08
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 475 813 1.0E-08
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 475 813 2.0E-08
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 475 813 2.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 697 813 2.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 702 813 3.0E-08
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 713 813 3.0E-08
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 712 812 4.0E-08
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 713 813 4.0E-08
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 712 812 5.0E-08
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 712 812 5.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 713 814 5.0E-08
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 712 812 5.0E-08
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 712 812 6.0E-08
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 713 813 6.0E-08
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 713 813 6.0E-08
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 712 812 6.0E-08
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 712 812 6.0E-08
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 713 813 6.0E-08
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 712 812 6.0E-08
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 712 812 7.0E-08
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 712 812 7.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 713 813 8.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 697 813 9.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 710 813 9.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 712 815 1.0E-07
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 712 812 1.0E-07
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 713 814 1.0E-07
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 713 813 1.0E-07
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 713 813 1.0E-07
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 475 781 1.0E-07
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 475 781 1.0E-07
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 713 813 1.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 713 813 1.0E-07
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 713 813 1.0E-07
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 713 813 1.0E-07
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 713 813 1.0E-07
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 713 813 1.0E-07
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 31 120 2.0E-07
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 365 555 2.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 710 813 2.0E-07
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 713 813 2.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 679 813 2.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 604 813 3.0E-07
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 713 813 3.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 712 813 4.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 713 813 4.0E-07
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 694 813 4.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 713 813 4.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 713 813 4.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 696 813 6.0E-07
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 690 813 6.0E-07
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 690 813 6.0E-07
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 31 120 8.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 713 814 8.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 696 813 1.0E-06
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 696 813 1.0E-06
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 696 813 1.0E-06
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 696 813 1.0E-06
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 713 813 1.0E-06
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 713 813 1.0E-06
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 445 813 1.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 696 813 1.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 713 814 1.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 713 793 2.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 696 813 2.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 715 813 2.0E-06
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 713 813 2.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 711 813 3.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 711 813 3.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 713 813 3.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 713 813 3.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 696 813 3.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 702 813 4.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 710 814 4.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 713 814 4.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 712 815 5.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 710 813 5.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 713 813 6.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 713 814 8.0E-06
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 473 815 9.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 627 813 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5719
MGPNAGNGMGGMEMGMAMHANGSNQPPATEYTLQGVMRFLQSEWHRHERDRNAWEIERQEMRGRIASLEGQARRA
DATQKALKKYVSILERKIKEQAAQLKGPAAADAAEQASNDRAASIQERLQASSDKHADGFHPGRPAADDDAQRNE
LKTFLDQCQAEFMYLMVTPANPQPPRESPPLPMMEDLREAEAYAMPPAGPQHMERQYQLQRAASNHAQELKPRPH
HQPSSAAPPQMQQPLPSAFAQGPSDFHQSQPMVRSAGEHQAAPMYAASNDWPAPVAVTTRAVDEAVPGPNHAAET
LDHAAEARDKPPADPEPDGWEFPDDTDVFPNAEYLPKSPNRVPSGHRRKGSLSRRRSGEHELALLSASQRADGGS
FKLRFGLRGHLDTVRTVIFSGGGSPGEPEICTAGDDAMIKRFHIPRLDSHAAPLGNAASDLDVIANFTHRGHSGS
VLSLTSWSPSPNFSTGGRAQGDGWIFSGGQDATIRVWERGRVDPKATLEGHTDAVWALCVLPATLGAIFGGSSAY
GSADRILLVSGAADSTVRLWSVSAPPQLSSPQPGTNRSMSGRAGRVRGNSMSSGSGFSNSPQPTTASNSPFHHTL
VHVIARSDGSKASPTSIAPLGGSGETFVVSYSDAAVIVYDTRNGEQVGQMDSMETYDGSIKTGVNAVVATTSGLD
QGGQHHGNGMGGDDDGGGGGGGPTGGRSMAGSGVEGTIISGHEDRFVRFFDANSGQCTYNMLAHPDAISSLSLSP
DGRELVSAGHDASLRFWSLEKRSCTQEITSHRVMRGEGVCSCVWSQDGKWVVSGGGDGVVKVFAR*
Coding >Hirsu2|5719
ATGGGCCCGAATGCTGGCAACGGCATGGGGGGGATGGAGATGGGCATGGCCATGCACGCTAACGGCTCCAACCAG
CCCCCGGCCACCGAATACACGCTGCAGGGCGTCATGCGCTTCCTCCAGTCCGAGTGGCATCGCCACGAGCGCGAC
CGAAACGCCTGGGAGATCGAGCGGCAGGAGATGAGGGGGAGGATAGCCAGCCTCGAGGGCCAGGCCAGGCGCGCC
GACGCCACCCAGAAGGCCCTGAAGAAATACGTGTCCATCCTGGAGCGCAAGATCAAGGAGCAGGCCGCCCAGCTC
AAGGGCCCTGCTGCCGCCGACGCGGCCGAGCAGGCCAGCAACGACCGCGCCGCCAGCATCCAAGAGAGGCTTCAA
GCATCCTCCGACAAGCACGCCGACGGCTTCCACCCCGGCAGGCCCGCCGCCGACGACGACGCCCAACGCAACGAG
CTCAAGACCTTCCTCGACCAGTGCCAGGCCGAGTTCATGTATCTCATGGTCACCCCCGCCAACCCGCAACCGCCG
CGCGAGTCTCCGCCGCTGCCCATGATGGAGGACCTGCGCGAGGCCGAGGCCTACGCCATGCCGCCTGCCGGCCCG
CAGCACATGGAGCGCCAGTACCAGCTCCAGCGGGCCGCCTCGAACCACGCGCAGGAGCTCAAGCCGAGGCCGCAC
CACCAGCCCTCGTCCGCCGCCCCCCCGCAGATGCAGCAGCCGCTTCCGTCCGCCTTCGCCCAAGGCCCGTCCGAC
TTCCACCAGTCCCAGCCCATGGTCCGCTCGGCCGGCGAACACCAGGCGGCGCCCATGTACGCCGCCTCCAACGAC
TGGCCGGCCCCGGTCGCCGTGACGACGCGCGCCGTCGACGAGGCCGTCCCGGGGCCCAACCACGCGGCCGAGACG
CTGGACCACGCGGCCGAGGCGAGGGACAAACCCCCCGCGGACCCCGAGCCCGACGGCTGGGAATTCCCGGACGAC
ACAGACGTCTTCCCCAACGCCGAGTACCTGCCCAAGTCGCCGAACCGAGTGCCGAGCGGCCACCGGAGGAAGGGC
TCCCTGTCGCGGCGGCGCAGCGGCGAGCACGAGCTGGCGCTGCTCAGCGCGAGCCAGCGAGCCGACGGCGGCAGC
TTCAAGCTGCGCTTCGGCCTGCGCGGCCACCTCGACACCGTCCGCACCGTCATCTTCTCCGGCGGCGGCAGCCCG
GGCGAGCCCGAGATCTGCACGGCCGGCGACGACGCCATGATCAAGCGCTTCCACATCCCCCGGCTCGACAGCCAC
GCCGCGCCGCTGGGCAACGCCGCGTCGGACCTCGACGTCATCGCCAACTTCACCCACCGCGGCCACTCGGGCTCC
GTGCTCTCGCTGACCTCGTGGTCGCCCTCGCCCAACTTCTCGACGGGCGGGCGGGCGCAGGGCGACGGCTGGATC
TTCTCGGGCGGCCAGGACGCCACGATCCGCGTCTGGGAGCGCGGCCGGGTGGACCCCAAGGCGACGCTCGAGGGC
CACACGGACGCCGTGTGGGCGCTCTGCGTGCTGCCCGCCACGCTCGGCGCCATCTTCGGCGGCTCGAGCGCGTAC
GGCAGCGCCGACCGGATCCTGCTCGTGTCGGGCGCGGCCGACTCGACGGTGCGGCTGTGGTCCGTCAGCGCGCCG
CCGCAGCTGAGCTCGCCGCAGCCGGGCACCAACCGCAGCATGTCGGGCCGGGCCGGGCGCGTGCGCGGCAACTCG
ATGAGCTCCGGCAGCGGCTTCTCCAACTCGCCGCAGCCGACGACGGCGTCCAACTCGCCCTTCCACCACACGCTC
GTGCACGTCATCGCCCGCTCGGACGGCTCCAAGGCCAGCCCGACGAGCATCGCGCCCCTGGGCGGCTCGGGCGAG
ACGTTCGTCGTCTCGTACTCAGACGCGGCCGTCATCGTCTACGACACGCGGAACGGCGAGCAGGTCGGGCAGATG
GACAGCATGGAGACATACGACGGGTCCATCAAGACGGGCGTCAACGCCGTGGTGGCGACGACGAGCGGGCTGGAC
CAGGGCGGCCAGCACCACGGCAACGGCATGGGCGGCGACGACGACGGCGGCGGCGGCGGCGGCGGGCCGACAGGA
GGCCGGTCCATGGCCGGGTCGGGCGTCGAGGGCACCATCATCTCCGGGCACGAGGACCGGTTCGTGCGATTCTTC
GACGCCAACAGCGGGCAATGCACCTACAACATGCTGGCGCACCCGGACGCCATCTCCAGCCTGTCTCTCAGCCCC
GACGGGCGGGAGCTGGTGAGCGCGGGCCACGACGCGTCGCTGCGCTTCTGGAGCCTGGAGAAGCGGTCGTGCACG
CAGGAGATTACGAGCCATCGGGTCATGCGCGGCGAGGGCGTGTGCTCGTGCGTCTGGAGCCAGGACGGGAAGTGG
GTGGTGAGCGGCGGAGGGGACGGCGTCGTCAAGGTGTTTGCGCGGTAG
Transcript >Hirsu2|5719
ATGGGCCCGAATGCTGGCAACGGCATGGGGGGGATGGAGATGGGCATGGCCATGCACGCTAACGGCTCCAACCAG
CCCCCGGCCACCGAATACACGCTGCAGGGCGTCATGCGCTTCCTCCAGTCCGAGTGGCATCGCCACGAGCGCGAC
CGAAACGCCTGGGAGATCGAGCGGCAGGAGATGAGGGGGAGGATAGCCAGCCTCGAGGGCCAGGCCAGGCGCGCC
GACGCCACCCAGAAGGCCCTGAAGAAATACGTGTCCATCCTGGAGCGCAAGATCAAGGAGCAGGCCGCCCAGCTC
AAGGGCCCTGCTGCCGCCGACGCGGCCGAGCAGGCCAGCAACGACCGCGCCGCCAGCATCCAAGAGAGGCTTCAA
GCATCCTCCGACAAGCACGCCGACGGCTTCCACCCCGGCAGGCCCGCCGCCGACGACGACGCCCAACGCAACGAG
CTCAAGACCTTCCTCGACCAGTGCCAGGCCGAGTTCATGTATCTCATGGTCACCCCCGCCAACCCGCAACCGCCG
CGCGAGTCTCCGCCGCTGCCCATGATGGAGGACCTGCGCGAGGCCGAGGCCTACGCCATGCCGCCTGCCGGCCCG
CAGCACATGGAGCGCCAGTACCAGCTCCAGCGGGCCGCCTCGAACCACGCGCAGGAGCTCAAGCCGAGGCCGCAC
CACCAGCCCTCGTCCGCCGCCCCCCCGCAGATGCAGCAGCCGCTTCCGTCCGCCTTCGCCCAAGGCCCGTCCGAC
TTCCACCAGTCCCAGCCCATGGTCCGCTCGGCCGGCGAACACCAGGCGGCGCCCATGTACGCCGCCTCCAACGAC
TGGCCGGCCCCGGTCGCCGTGACGACGCGCGCCGTCGACGAGGCCGTCCCGGGGCCCAACCACGCGGCCGAGACG
CTGGACCACGCGGCCGAGGCGAGGGACAAACCCCCCGCGGACCCCGAGCCCGACGGCTGGGAATTCCCGGACGAC
ACAGACGTCTTCCCCAACGCCGAGTACCTGCCCAAGTCGCCGAACCGAGTGCCGAGCGGCCACCGGAGGAAGGGC
TCCCTGTCGCGGCGGCGCAGCGGCGAGCACGAGCTGGCGCTGCTCAGCGCGAGCCAGCGAGCCGACGGCGGCAGC
TTCAAGCTGCGCTTCGGCCTGCGCGGCCACCTCGACACCGTCCGCACCGTCATCTTCTCCGGCGGCGGCAGCCCG
GGCGAGCCCGAGATCTGCACGGCCGGCGACGACGCCATGATCAAGCGCTTCCACATCCCCCGGCTCGACAGCCAC
GCCGCGCCGCTGGGCAACGCCGCGTCGGACCTCGACGTCATCGCCAACTTCACCCACCGCGGCCACTCGGGCTCC
GTGCTCTCGCTGACCTCGTGGTCGCCCTCGCCCAACTTCTCGACGGGCGGGCGGGCGCAGGGCGACGGCTGGATC
TTCTCGGGCGGCCAGGACGCCACGATCCGCGTCTGGGAGCGCGGCCGGGTGGACCCCAAGGCGACGCTCGAGGGC
CACACGGACGCCGTGTGGGCGCTCTGCGTGCTGCCCGCCACGCTCGGCGCCATCTTCGGCGGCTCGAGCGCGTAC
GGCAGCGCCGACCGGATCCTGCTCGTGTCGGGCGCGGCCGACTCGACGGTGCGGCTGTGGTCCGTCAGCGCGCCG
CCGCAGCTGAGCTCGCCGCAGCCGGGCACCAACCGCAGCATGTCGGGCCGGGCCGGGCGCGTGCGCGGCAACTCG
ATGAGCTCCGGCAGCGGCTTCTCCAACTCGCCGCAGCCGACGACGGCGTCCAACTCGCCCTTCCACCACACGCTC
GTGCACGTCATCGCCCGCTCGGACGGCTCCAAGGCCAGCCCGACGAGCATCGCGCCCCTGGGCGGCTCGGGCGAG
ACGTTCGTCGTCTCGTACTCAGACGCGGCCGTCATCGTCTACGACACGCGGAACGGCGAGCAGGTCGGGCAGATG
GACAGCATGGAGACATACGACGGGTCCATCAAGACGGGCGTCAACGCCGTGGTGGCGACGACGAGCGGGCTGGAC
CAGGGCGGCCAGCACCACGGCAACGGCATGGGCGGCGACGACGACGGCGGCGGCGGCGGCGGCGGGCCGACAGGA
GGCCGGTCCATGGCCGGGTCGGGCGTCGAGGGCACCATCATCTCCGGGCACGAGGACCGGTTCGTGCGATTCTTC
GACGCCAACAGCGGGCAATGCACCTACAACATGCTGGCGCACCCGGACGCCATCTCCAGCCTGTCTCTCAGCCCC
GACGGGCGGGAGCTGGTGAGCGCGGGCCACGACGCGTCGCTGCGCTTCTGGAGCCTGGAGAAGCGGTCGTGCACG
CAGGAGATTACGAGCCATCGGGTCATGCGCGGCGAGGGCGTGTGCTCGTGCGTCTGGAGCCAGGACGGGAAGTGG
GTGGTGAGCGGCGGAGGGGACGGCGTCGTCAAGGTGTTTGCGCGGTAG
Gene >Hirsu2|5719
ATGGGCCCGAATGCTGGCAACGGCATGGGGGGGATGGAGATGGGCATGGCCATGCACGCTAACGGCTCCAACCAG
CCCCCGGCCACCGAATACACGCTGCAGGGCGTCATGCGCTTCCTCCAGTCCGAGTGGCATCGCCACGAGCGCGAC
CGAAACGCCTGGGAGATCGAGCGGCAGGAGATGAGGGGGAGGATAGCCAGCCTCGAGGGCCAGGCCAGGCGCGCC
GACGCCACCCAGAAGGCCCTGAAGAAATACGTGTCCATCCTGGAGCGCAAGATCAAGGAGCAGGCCGCCCAGCTC
AAGGGCCCTGCTGCCGCCGACGCGGCCGAGCAGGCCAGCAACGACCGCGCCGCCAGCATCCAAGAGAGGCTTCAA
GGTGAGAGGGCTCCGAAAAGGCTCCCCTGGCCGCCCGCCCCCCCGCTGACCGACGCCGACGCCTCGCCAGCATCC
TCCGACAAGCACGCCGACGGCTTCCACCCCGGCAGGCCCGCCGCCGACGACGACGCCCAACGCAACGAGCTCAAG
ACCTTCCTCGACCAGTGCCAGGCCGAGTTCATGTATCTCATGGTCACCCCCGCCAACCCGCAACCGCCGCGCGAG
TCTCCGCCGCTGCCCATGATGGAGGACCTGCGCGAGGCCGAGGCCTACGCCATGCCGCCTGCCGGCCCGCAGCAC
ATGGAGCGCCAGTACCAGCTCCAGCGGGCCGCCTCGAACCACGCGCAGGAGCTCAAGCCGAGGCCGCACCACCAG
CCCTCGTCCGCCGCCCCCCCGCAGATGCAGCAGCCGCTTCCGTCCGCCTTCGCCCAAGGCCCGTCCGACTTCCAC
CAGTCCCAGCCCATGGTCCGCTCGGCCGGCGAACACCAGGCGGCGCCCATGTACGCCGCCTCCAACGACTGGCCG
GCCCCGGTCGCCGTGACGACGCGCGCCGTCGACGAGGCCGTCCCGGGGCCCAACCACGCGGCCGAGACGCTGGAC
CACGCGGCCGAGGCGAGGGACAAACCCCCCGCGGACCCCGAGCCCGACGGCTGGGAATTCCCGGACGGTACGTTT
GCGGATCAGGGGGCCTCCCATCACCAGCAGCAGCAGCAGCAACAGCTCGTCTCATCCGCATCGAACCGACCAGAC
ACAGACGTCTTCCCCAACGCCGAGTACCTGCCCAAGTCGCCGAACCGAGTGCCGAGCGGCCACCGGAGGAAGGGC
TCCCTGTCGCGGCGGCGCAGCGGCGAGCACGAGCTGGCGCTGCTCAGCGCGAGCCAGCGAGCCGACGGCGGCAGC
TTCAAGCTGCGCTTCGGCCTGCGCGGCCACCTCGACACCGTCCGCACCGTCATCTTCTCCGGCGGCGGCAGCCCG
GGCGAGCCCGAGATCTGCACGGCCGGCGACGACGCCATGATCAAGCGCTTCCACATCCCCCGGCTCGACAGCCAC
GCCGCGCCGCTGGGCAACGCCGCGTCGGACCTCGACGTCATCGCCAACTTCACCCACCGCGGCCACTCGGGCTCC
GTGCTCTCGCTGACCTCGTGGTCGCCCTCGCCCAACTTCTCGACGGGCGGGCGGGCGCAGGGCGACGGCTGGATC
TTCTCGGGCGGCCAGGACGCCACGATCCGCGTCTGGGAGCGCGGCCGGGTGGACCCCAAGGCGACGCTCGAGGGC
CACACGGACGCCGTGTGGGCGCTCTGCGTGCTGCCCGCCACGCTCGGCGCCATCTTCGGCGGCTCGAGCGCGTAC
GGCAGCGCCGACCGGATCCTGCTCGTGTCGGGCGCGGCCGACTCGACGGTGCGGCTGTGGTCCGTCAGCGCGCCG
CCGCAGCTGAGCTCGCCGCAGCCGGGCACCAACCGCAGCATGTCGGGCCGGGCCGGGCGCGTGCGCGGCAACTCG
ATGAGCTCCGGCAGCGGCTTCTCCAACTCGCCGCAGCCGACGACGGCGTCCAACTCGCCCTTCCACCACACGCTC
GTGCACGTCATCGCCCGCTCGGACGGCTCCAAGGCCAGCCCGACGAGCATCGCGCCCCTGGGCGGCTCGGGCGAG
ACGTTCGTCGTCTCGTACTCAGACGCGGCCGTCATCGTCTACGACACGCGGAACGGCGAGCAGGTCGGGCAGATG
GACAGCATGGAGACATACGACGGGTCCATCAAGACGGGCGTCAACGCCGTGGTGGCGACGACGAGCGGGCTGGAC
CAGGGCGGCCAGCACCACGGCAACGGCATGGGCGGCGACGACGACGGCGGCGGCGGCGGCGGCGGGCCGACAGGA
GGCCGGTCCATGGCCGGGTCGGGCGTCGAGGGCACCATCATCTCCGGGCACGAGGACCGGTTCGTGCGATTCTTC
GACGCCAACAGCGGTAAGTCGGGCCACCACGGGCGGGGAGCGGCCGGCCGGGGCTAACGGGCGGCGGCAGGGCAA
TGCACCTACAACATGCTGGCGCACCCGGACGCCATCTCCAGCCTGTCTCTCAGCCCCGACGGGCGGGAGCTGGTG
AGCGCGGGCCACGACGCGTCGCTGCGCTTCTGGAGCCTGGAGAAGCGGTCGTGCACGCAGGAGATTACGAGCCAT
CGGGTCATGCGCGGCGAGGGCGTGTGCTCGTGCGTCTGGAGCCAGGACGGGAAGTGGGTGGTGAGCGGCGGAGGG
GACGGCGTCGTCAAGGTGTTTGCGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail