Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5717
Gene name
LocationContig_288:988..4322
Strand-
Gene length (bp)3334
Transcript length (bp)2952
Coding sequence length (bp)2952
Protein length (aa) 984

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00637 Clathrin Region in Clathrin and VPS 8.5E-21 408 536
PF12451 VPS11_C Vacuolar protein sorting protein 11 C terminal 4.7E-16 929 973
PF17122 zf-C3H2C3 Zinc-finger 9.7E-07 886 925

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 4 973 3.0E-162
sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 34 973 2.0E-147
sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 34 973 1.0E-146
sp|P12868|PEP5_YEAST E3 ubiquitin-protein ligase PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP5 PE=1 SV=2 4 972 3.0E-97
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 6 598 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 4 973 3.0E-162
sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 34 973 2.0E-147
sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 34 973 1.0E-146
sp|P12868|PEP5_YEAST E3 ubiquitin-protein ligase PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP5 PE=1 SV=2 4 972 3.0E-97
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 6 598 2.0E-92
sp|Q9P6N4|PEP5_SCHPO E3 ubiquitin-protein ligase pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps11 PE=3 SV=1 4 925 1.0E-85
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 723 978 4.0E-37
sp|Q09600|VPS11_CAEEL Vacuolar protein sorting-associated protein 11 homolog OS=Caenorhabditis elegans GN=vps-11 PE=3 SV=2 5 527 2.0E-35
sp|Q8I480|ZNRF2_PLAF7 RING finger protein PFE0100w OS=Plasmodium falciparum (isolate 3D7) GN=PFE0100w PE=3 SV=1 348 531 2.0E-18
sp|P87295|PEP5L_SCHPO Pep5-like zinc finger protein C16A10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.03c PE=3 SV=2 5 223 4.0E-14
sp|Q09600|VPS11_CAEEL Vacuolar protein sorting-associated protein 11 homolog OS=Caenorhabditis elegans GN=vps-11 PE=3 SV=2 771 973 1.0E-11
sp|Q8I480|ZNRF2_PLAF7 RING finger protein PFE0100w OS=Plasmodium falciparum (isolate 3D7) GN=PFE0100w PE=3 SV=1 886 971 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0006886 intracellular protein transport Yes
GO:0015031 protein transport No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0045184 establishment of protein localization No
GO:0046907 intracellular transport No
GO:0015833 peptide transport No
GO:0033036 macromolecule localization No
GO:0071705 nitrogen compound transport No
GO:0071702 organic substance transport No
GO:0008150 biological_process No
GO:0008104 protein localization No
GO:0042886 amide transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5717
MAISWKSFDFFDVSNVALADDDTRQLFEGNEIASVCAGSDSLFVGSNDGFVSIIGKAWKVLRRFQAHDAGRITHM
RQLEGTSILVTVAEDLSSEPVLKAWALDKLMKKTNMPTCLSTLTVNNGRRQYPISAFAALEDLSQVAVGFGNGAV
TVIRGDLIHDLGTKQRIVFESEEPVTGVQLVADEKLTTLFVSTTSRIIKLGLSRKGQGMPPKTVEDAGCAVGCMT
IDRDTGQVIVARDDAIYTYTLEGRGPLRAYESPKSMIALYENYVALACPSSNASSRDPDAMRRRFGGSATDALFS
ASSFILLDTDLRVIAHTGTLISPVRFIFSVWGNLFTIDQEGKVYQYHEKALQQRLDMLYQRNMYPLAVELAQNSG
MDAKQQTFIYRKFGDHLYQKADYDGAMVQYIRAIDTTEPSQVIRKFLDTQRIHNLIQYLEQLHEHRSASADHTTL
LLNCYAKLKDIDKLERFIKSPGDLKFDLDTAIAMCRQGGYYEQAAYLAKRHGETELVVDILIEDSKSYAEALDFI
SRQDPDIAYTCLQKSARVLIENCPREATSLFVDYYTGRYRPKRATTASRDDRTPQTGGFAASAVQNLSSLLPFPY
MNSSSIASPTGGMTTGEAGGETITAATVDSDDDPAPKYTPPPPRTAFSSFIDHPDEFIVFLEACLEDKDLKASDK
RDLYTTLFEMYLHKSNEQQQRGGKDEWEDKAKKLIEGEHVPMESSNVLLLSHLTDFKEGTVMVKEQAGLLFDIFR
SYTTAKDTRGALKALKKYGPEEPQLYAVALAYLASDARVLQEAGPDELAGILSKIDKDGLMAPLQVIQTLAGQSS
GGGAATVGMVKPYLHETITRERREIVSNRQRIERFRADTDKRRAELADLGAKPAVFQATRCADCGQGLDLPAVHF
LCKHSFHQRCLRGGGDEDEMECPKCAGENEVIRKMRAAQRETSAKHELFRGDLEGSEDRFATMAEWFSRGVMDAG
RDSEQPYA*
Coding >Hirsu2|5717
ATGGCCATCTCGTGGAAGTCGTTCGACTTCTTCGACGTCTCCAACGTCGCCCTCGCCGACGACGACACGCGCCAG
CTCTTCGAGGGTAACGAGATTGCGAGCGTCTGCGCTGGCTCCGACAGCCTCTTCGTCGGCTCCAACGATGGCTTC
GTCAGCATCATCGGCAAGGCCTGGAAGGTGCTCAGGAGGTTCCAGGCCCACGACGCCGGCCGCATCACCCACATG
CGACAGCTCGAAGGCACCAGCATACTTGTGACGGTGGCGGAGGATCTCAGCAGCGAACCGGTGCTCAAGGCTTGG
GCTCTGGACAAGCTGATGAAGAAGACCAACATGCCCACCTGCTTGAGCACCCTGACCGTGAACAACGGGAGGCGC
CAATATCCGATATCAGCATTTGCAGCGCTCGAAGATCTGTCGCAGGTCGCCGTCGGCTTCGGAAACGGCGCCGTC
ACCGTCATTCGCGGCGATCTCATCCACGACCTGGGAACCAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCCCGTC
ACGGGCGTGCAGCTCGTCGCTGACGAGAAGCTGACCACACTCTTCGTCTCCACCACGTCGCGCATCATCAAGCTG
GGCCTATCGCGCAAGGGCCAAGGCATGCCCCCGAAAACGGTCGAGGATGCCGGATGTGCCGTCGGTTGCATGACC
ATCGATCGCGACACGGGGCAGGTGATCGTGGCCCGCGACGACGCGATATATACCTACACGCTCGAAGGGCGGGGA
CCGCTGCGGGCCTACGAGTCGCCCAAGAGCATGATTGCCTTGTATGAGAACTACGTTGCGTTGGCCTGCCCGTCG
TCCAACGCAAGCAGCCGCGATCCCGACGCCATGCGGCGCCGCTTTGGCGGCAGCGCGACCGACGCTCTCTTCAGC
GCCTCGTCCTTTATTCTCCTGGACACCGACTTGCGCGTCATAGCCCACACGGGGACCCTTATATCCCCCGTCCGC
TTCATTTTCAGCGTCTGGGGAAACCTCTTCACCATAGACCAGGAAGGCAAAGTCTACCAATACCACGAAAAGGCG
TTGCAGCAGAGGCTGGACATGTTGTACCAAAGAAACATGTATCCGCTTGCCGTCGAGTTGGCCCAGAACTCGGGC
ATGGACGCCAAACAGCAGACCTTCATCTATCGCAAGTTTGGCGATCATCTCTACCAGAAGGCCGACTACGATGGC
GCCATGGTGCAGTACATACGCGCCATCGACACCACCGAGCCCTCGCAGGTCATTCGCAAGTTCCTCGACACGCAG
CGAATCCATAACTTGATACAGTATCTTGAGCAACTGCACGAGCATAGGAGCGCCTCGGCCGATCACACGACACTG
CTGCTCAACTGCTACGCAAAGCTGAAGGACATCGACAAGCTGGAGAGGTTTATCAAGTCTCCCGGCGACCTCAAG
TTTGACCTGGACACGGCGATTGCCATGTGTCGCCAGGGCGGCTACTACGAACAGGCCGCCTACCTGGCCAAGAGG
CACGGCGAGACGGAACTTGTCGTCGACATCTTGATTGAGGACTCCAAGAGCTATGCCGAAGCGCTGGACTTTATT
TCGCGTCAAGACCCGGACATCGCCTACACTTGTCTTCAAAAGTCGGCCCGCGTGCTCATTGAGAACTGCCCCAGG
GAGGCGACGTCGTTGTTTGTCGACTACTACACCGGGAGATACAGACCCAAACGCGCGACGACGGCTTCACGGGAT
GACAGGACACCGCAAACCGGTGGCTTTGCCGCCTCGGCCGTGCAGAATCTGTCCAGCCTCCTGCCCTTCCCCTAC
ATGAACTCTTCGTCCATAGCAAGCCCGACCGGCGGCATGACGACGGGAGAGGCGGGCGGCGAGACAATCACGGCT
GCGACGGTGGACTCGGATGACGATCCGGCCCCCAAGTATACCCCCCCGCCCCCGCGGACGGCCTTTTCATCCTTC
ATCGACCATCCGGACGAATTCATCGTCTTTCTCGAGGCATGCCTGGAGGACAAGGACCTCAAGGCGTCGGACAAG
AGGGACCTATACACGACGCTGTTCGAGATGTATCTGCACAAGTCGAACGAGCAGCAGCAGCGAGGCGGCAAAGAC
GAATGGGAGGACAAGGCCAAGAAACTGATCGAAGGCGAACACGTGCCGATGGAAAGCTCCAACGTGCTGCTCCTG
TCACACCTAACCGACTTCAAGGAAGGTACCGTTATGGTCAAGGAGCAGGCCGGCCTGCTGTTCGACATCTTCCGG
TCGTATACGACGGCCAAGGATACGAGGGGCGCGCTCAAGGCGCTGAAGAAGTACGGGCCGGAGGAGCCGCAGCTG
TACGCGGTGGCGCTGGCATACCTGGCGTCGGACGCGCGGGTGCTCCAGGAGGCGGGGCCCGACGAGCTGGCCGGG
ATACTGTCCAAGATCGACAAGGACGGGCTCATGGCGCCGCTGCAGGTCATCCAGACGCTCGCGGGGCAGTCGTCC
GGGGGCGGGGCGGCGACGGTGGGCATGGTCAAGCCGTACCTGCACGAGACGATCACGCGCGAGCGGCGGGAGATT
GTGTCGAACCGGCAGCGCATCGAGCGGTTCCGGGCCGACACGGACAAGAGGCGGGCCGAGCTGGCGGACCTCGGG
GCCAAGCCGGCCGTGTTCCAGGCGACGCGCTGCGCCGACTGCGGCCAGGGGCTGGACCTGCCGGCGGTGCATTTC
CTGTGCAAGCACAGCTTCCACCAGCGGTGCCTGCGGGGCGGCGGGGACGAGGACGAGATGGAGTGCCCCAAGTGC
GCGGGCGAGAACGAGGTGATTCGGAAGATGCGGGCGGCGCAGCGGGAGACGTCGGCGAAGCACGAGCTGTTCCGG
GGGGATCTCGAGGGGAGCGAGGACCGGTTCGCGACCATGGCCGAGTGGTTCTCGCGGGGCGTCATGGATGCCGGG
CGGGATTCGGAGCAGCCGTACGCTTGA
Transcript >Hirsu2|5717
ATGGCCATCTCGTGGAAGTCGTTCGACTTCTTCGACGTCTCCAACGTCGCCCTCGCCGACGACGACACGCGCCAG
CTCTTCGAGGGTAACGAGATTGCGAGCGTCTGCGCTGGCTCCGACAGCCTCTTCGTCGGCTCCAACGATGGCTTC
GTCAGCATCATCGGCAAGGCCTGGAAGGTGCTCAGGAGGTTCCAGGCCCACGACGCCGGCCGCATCACCCACATG
CGACAGCTCGAAGGCACCAGCATACTTGTGACGGTGGCGGAGGATCTCAGCAGCGAACCGGTGCTCAAGGCTTGG
GCTCTGGACAAGCTGATGAAGAAGACCAACATGCCCACCTGCTTGAGCACCCTGACCGTGAACAACGGGAGGCGC
CAATATCCGATATCAGCATTTGCAGCGCTCGAAGATCTGTCGCAGGTCGCCGTCGGCTTCGGAAACGGCGCCGTC
ACCGTCATTCGCGGCGATCTCATCCACGACCTGGGAACCAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCCCGTC
ACGGGCGTGCAGCTCGTCGCTGACGAGAAGCTGACCACACTCTTCGTCTCCACCACGTCGCGCATCATCAAGCTG
GGCCTATCGCGCAAGGGCCAAGGCATGCCCCCGAAAACGGTCGAGGATGCCGGATGTGCCGTCGGTTGCATGACC
ATCGATCGCGACACGGGGCAGGTGATCGTGGCCCGCGACGACGCGATATATACCTACACGCTCGAAGGGCGGGGA
CCGCTGCGGGCCTACGAGTCGCCCAAGAGCATGATTGCCTTGTATGAGAACTACGTTGCGTTGGCCTGCCCGTCG
TCCAACGCAAGCAGCCGCGATCCCGACGCCATGCGGCGCCGCTTTGGCGGCAGCGCGACCGACGCTCTCTTCAGC
GCCTCGTCCTTTATTCTCCTGGACACCGACTTGCGCGTCATAGCCCACACGGGGACCCTTATATCCCCCGTCCGC
TTCATTTTCAGCGTCTGGGGAAACCTCTTCACCATAGACCAGGAAGGCAAAGTCTACCAATACCACGAAAAGGCG
TTGCAGCAGAGGCTGGACATGTTGTACCAAAGAAACATGTATCCGCTTGCCGTCGAGTTGGCCCAGAACTCGGGC
ATGGACGCCAAACAGCAGACCTTCATCTATCGCAAGTTTGGCGATCATCTCTACCAGAAGGCCGACTACGATGGC
GCCATGGTGCAGTACATACGCGCCATCGACACCACCGAGCCCTCGCAGGTCATTCGCAAGTTCCTCGACACGCAG
CGAATCCATAACTTGATACAGTATCTTGAGCAACTGCACGAGCATAGGAGCGCCTCGGCCGATCACACGACACTG
CTGCTCAACTGCTACGCAAAGCTGAAGGACATCGACAAGCTGGAGAGGTTTATCAAGTCTCCCGGCGACCTCAAG
TTTGACCTGGACACGGCGATTGCCATGTGTCGCCAGGGCGGCTACTACGAACAGGCCGCCTACCTGGCCAAGAGG
CACGGCGAGACGGAACTTGTCGTCGACATCTTGATTGAGGACTCCAAGAGCTATGCCGAAGCGCTGGACTTTATT
TCGCGTCAAGACCCGGACATCGCCTACACTTGTCTTCAAAAGTCGGCCCGCGTGCTCATTGAGAACTGCCCCAGG
GAGGCGACGTCGTTGTTTGTCGACTACTACACCGGGAGATACAGACCCAAACGCGCGACGACGGCTTCACGGGAT
GACAGGACACCGCAAACCGGTGGCTTTGCCGCCTCGGCCGTGCAGAATCTGTCCAGCCTCCTGCCCTTCCCCTAC
ATGAACTCTTCGTCCATAGCAAGCCCGACCGGCGGCATGACGACGGGAGAGGCGGGCGGCGAGACAATCACGGCT
GCGACGGTGGACTCGGATGACGATCCGGCCCCCAAGTATACCCCCCCGCCCCCGCGGACGGCCTTTTCATCCTTC
ATCGACCATCCGGACGAATTCATCGTCTTTCTCGAGGCATGCCTGGAGGACAAGGACCTCAAGGCGTCGGACAAG
AGGGACCTATACACGACGCTGTTCGAGATGTATCTGCACAAGTCGAACGAGCAGCAGCAGCGAGGCGGCAAAGAC
GAATGGGAGGACAAGGCCAAGAAACTGATCGAAGGCGAACACGTGCCGATGGAAAGCTCCAACGTGCTGCTCCTG
TCACACCTAACCGACTTCAAGGAAGGTACCGTTATGGTCAAGGAGCAGGCCGGCCTGCTGTTCGACATCTTCCGG
TCGTATACGACGGCCAAGGATACGAGGGGCGCGCTCAAGGCGCTGAAGAAGTACGGGCCGGAGGAGCCGCAGCTG
TACGCGGTGGCGCTGGCATACCTGGCGTCGGACGCGCGGGTGCTCCAGGAGGCGGGGCCCGACGAGCTGGCCGGG
ATACTGTCCAAGATCGACAAGGACGGGCTCATGGCGCCGCTGCAGGTCATCCAGACGCTCGCGGGGCAGTCGTCC
GGGGGCGGGGCGGCGACGGTGGGCATGGTCAAGCCGTACCTGCACGAGACGATCACGCGCGAGCGGCGGGAGATT
GTGTCGAACCGGCAGCGCATCGAGCGGTTCCGGGCCGACACGGACAAGAGGCGGGCCGAGCTGGCGGACCTCGGG
GCCAAGCCGGCCGTGTTCCAGGCGACGCGCTGCGCCGACTGCGGCCAGGGGCTGGACCTGCCGGCGGTGCATTTC
CTGTGCAAGCACAGCTTCCACCAGCGGTGCCTGCGGGGCGGCGGGGACGAGGACGAGATGGAGTGCCCCAAGTGC
GCGGGCGAGAACGAGGTGATTCGGAAGATGCGGGCGGCGCAGCGGGAGACGTCGGCGAAGCACGAGCTGTTCCGG
GGGGATCTCGAGGGGAGCGAGGACCGGTTCGCGACCATGGCCGAGTGGTTCTCGCGGGGCGTCATGGATGCCGGG
CGGGATTCGGAGCAGCCGTACGCTTGA
Gene >Hirsu2|5717
ATGGCCATCTCGGTAGCCTTCGCCCGACAGCTTCCCTCCCCCTTTGACCAGCAGCTGACGGCTCGGACAGTGGAA
GTCGTTCGACTTCTTCGACGTCTCCAACGTCGCCCTCGCCGACGACGACACGCGCCAGCTCTTCGAGGGTAACGA
GATTGCGAGCGTCTGCGCTGGCTCCGACAGCCTCTTCGTCGGCTCCAACGATGGCTTCGTCAGCATCATCGGCAA
GGCCTGGAAGGTGCTCAGGAGGTTCCAGGCCCACGACGCCGGCCGCATCACCCACATGCGACAGCTCGAAGGCAC
CAGCATACTTGTGACGGTGGCGGTTGGCAGCCCCCCCCCTTCCGTGCACTCCCCGGACGGCTACCACCGACTGTG
CGTGCTTCATGGAGCTGGAGCGCTGACGGTCGTCGCAGGAGGATCTCAGCAGCGAACCGGTGCTCAAGGCTTGGG
CTCTGGACAAGCTGATGAAGAAGACCAACATGCCCACCTGCTTGAGCACCCTGACCGTGAACAACGGGAGGCGCC
AATATCCGGTGGGCAGCCCACCTTCTGAAACGTCTTGCCTGCCTAAAAAAGCTGACAGACGGTCAAGATATCAGC
ATTTGCAGCGCTCGAAGATCTGTCGCAGGTCGCCGTCGGCTTCGGAAACGGCGCCGTCACCGTCATTCGCGGCGA
TCTCATCCACGACCTGGGAACCAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCCCGTCACGGGCGTGCAGCTCGT
CGCTGACGAGAAGCTGACCACACTCTTCGTCTCCACCACGTCGCGCATCATCAAGCTGGGCCTATCGCGCAAGGG
CCAAGGCATGCCCCCGAAAACGGTCGAGGATGCCGGATGTGCCGTCGGTTGCATGACCATCGATCGCGACACGGG
GCAGGTGATCGTGGCCCGCGACGACGCGATATATACCTACACGCTCGAAGGGCGGGGACCGCTGCGGGCCTACGA
GTCGCCCAAGAGCATGATTGCCTTGTATGAGAACTACGTTGCGTTGGCCTGCCCGTCGTCCAACGCAAGCAGCCG
CGATCCCGACGCCATGCGGCGCCGCTTTGGCGGCAGCGCGACCGACGCTCTCTTCAGCGCCTCGTCCTTTATTCT
CCTGGACACCGACTTGCGCGTCATAGCCCACACGGGGACCCTTATATCCCCCGTCCGCTTCATTTTCAGCGTCTG
GGGAAACCTCTTCACCATAGACCAGGAAGGCAAAGTGAGAGTTGCGTCCAGTCGACTGCTGTGCGACTGCGTGCT
GACTAGTCAGGTCTACCAATACCACGAAAAGGCGTTGCAGCAGAGGCTGGACATGTTGTACCAAAGAAACATGTA
TCCGCTTGCCGTCGAGTTGGCCCAGAACTCGGGCATGGACGCCAAACAGCAGACCTTCATCTATCGCAAGTTTGG
CGATCATCTCTACCAGAAGGCCGACTACGATGGCGCCATGGTGCAGTACATACGCGCCATCGACACCACCGAGCC
CTCGCAGGTCATTCGCAAGGTATGACGCCGCACGCAGCCGCCTGGATCTCGTGATTTCTGACAAGGCGGGCACAG
TTCCTCGACACGCAGCGAATCCATAACTTGATACAGTATCTTGAGCAACTGCACGAGCATAGGAGCGCCTCGGCC
GATCACACGACACTGCTGCTCAACTGCTACGCAAAGCTGAAGGACATCGACAAGCTGGAGAGGTTTATCAAGTCT
CCCGGCGACCTCAAGTTTGACCTGGACACGGCGATTGCCATGTGTCGCCAGGGCGGCTACTACGAACAGGCCGCC
TACCTGGCCAAGAGGCACGGCGAGACGGAACTTGTCGTCGACATCTTGATTGAGGACTCCAAGAGCTATGCCGAA
GCGCTGGACTTTATTTCGCGTCAAGACCCGGACATCGTACGTCTCCCCTCTCCCTCATCGCCCAATTGTGTTCCC
CACGGCCTCTTTCGCTGACCTGGCCCAGGCCTACACTTGTCTTCAAAAGTCGGCCCGCGTGCTCATTGAGAACTG
CCCCAGGGAGGCGACGTCGTTGTTTGTCGACTACTACACCGGGAGATACAGACCCAAACGCGCGACGACGGCTTC
ACGGGATGACAGGACACCGCAAACCGGTGGCTTTGCCGCCTCGGCCGTGCAGAATCTGTCCAGCCTCCTGCCCTT
CCCCTACATGAACTCTTCGTCCATAGCAAGCCCGACCGGCGGCATGACGACGGGAGAGGCGGGCGGCGAGACAAT
CACGGCTGCGACGGTGGACTCGGATGACGATCCGGCCCCCAAGTATACCCCCCCGCCCCCGCGGACGGCCTTTTC
ATCCTTCATCGACCATCCGGACGAATTCATCGTCTTTCTCGAGGCATGCCTGGAGGACAAGGACCTCAAGGCGTC
GGACAAGAGGGACCTATACACGACGCTGTTCGAGATGTATCTGCACAAGTCGAACGAGCAGCAGCAGCGAGGCGG
CAAAGACGAATGGGAGGACAAGGCCAAGAAACTGATCGAAGGCGAACACGTGCCGATGGAAAGCTCCAACGTGCT
GCTCCTGTCACACCTAACCGACTTCAAGGAAGGTACCGTTATGGTCAAGGAGCAGGCCGGCCTGCTGTTCGACAT
CTTCCGGTCGTATACGACGGCCAAGGATACGAGGGGCGCGCTCAAGGCGCTGAAGAAGTACGGGCCGGAGGAGCC
GCAGCTGTACGCGGTGGCGCTGGCATACCTGGCGTCGGACGCGCGGGTGCTCCAGGAGGCGGGGCCCGACGAGCT
GGCCGGGATACTGTCCAAGATCGACAAGGACGGGCTCATGGCGCCGCTGCAGGTCATCCAGACGCTCGCGGGGCA
GTCGTCCGGGGGCGGGGCGGCGACGGTGGGCATGGTCAAGCCGTACCTGCACGAGACGATCACGCGCGAGCGGCG
GGAGATTGTGTCGAACCGGCAGCGCATCGAGCGGTTCCGGGCCGACACGGACAAGAGGCGGGCCGAGCTGGCGGA
CCTCGGGGCCAAGCCGGCCGTGTTCCAGGCGACGCGCTGCGCCGACTGCGGCCAGGGGCTGGACCTGCCGGCGGT
GCATTTCCTGTGCAAGCACAGCTTCCACCAGCGGTGCCTGCGGGGCGGCGGGGACGAGGACGAGATGGAGTGCCC
CAAGTGCGCGGGCGAGAACGAGGTGATTCGGAAGATGCGGGCGGCGCAGCGGGAGACGTCGGCGAAGCACGAGCT
GTTCCGGGGGGATCTCGAGGGGAGCGAGGACCGGTTCGCGACCATGGCCGAGTGGTTCTCGCGGGGCGTCATGGA
TGCCGGGCGGGATTCGGAGCAGCCGTACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail