Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5707
Gene name
LocationContig_287:22440..23190
Strand+
Gene length (bp)750
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03073 TspO_MBR TspO/MBR family 9.7E-46 21 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94327|TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.10 PE=3 SV=2 20 175 9.0E-26
sp|P30536|TSPOA_HUMAN Translocator protein OS=Homo sapiens GN=TSPO PE=1 SV=3 11 167 3.0E-18
sp|P50637|TSPO_MOUSE Translocator protein OS=Mus musculus GN=Tspo PE=1 SV=1 18 167 7.0E-18
sp|P16257|TSPO_RAT Translocator protein OS=Rattus norvegicus GN=Tspo PE=1 SV=1 18 167 3.0E-17
sp|O28797|TSPO_ARCFU Tryptophan-rich protein TspO OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tspO PE=3 SV=1 19 175 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94327|TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.10 PE=3 SV=2 20 175 9.0E-26
sp|P30536|TSPOA_HUMAN Translocator protein OS=Homo sapiens GN=TSPO PE=1 SV=3 11 167 3.0E-18
sp|P50637|TSPO_MOUSE Translocator protein OS=Mus musculus GN=Tspo PE=1 SV=1 18 167 7.0E-18
sp|P16257|TSPO_RAT Translocator protein OS=Rattus norvegicus GN=Tspo PE=1 SV=1 18 167 3.0E-17
sp|O28797|TSPO_ARCFU Tryptophan-rich protein TspO OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tspO PE=3 SV=1 19 175 3.0E-17
sp|P30535|TSPO_BOVIN Translocator protein OS=Bos taurus GN=TSPO PE=2 SV=1 11 167 7.0E-17
sp|Q9GMC9|TSPO_SHEEP Translocator protein OS=Ovis aries GN=TSPO PE=1 SV=1 11 167 2.0E-16
sp|Q8KBX2|TSPO_CHLTE Tryptophan-rich protein TspO OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=crtK-2 PE=1 SV=1 24 175 4.0E-15
sp|Q6UN27|TSPO_PIG Translocator protein OS=Sus scrofa GN=TSPO PE=2 SV=1 18 167 5.0E-14
sp|Q9RFC8|TSPO_RHOSH Tryptophan-rich sensory protein OS=Rhodobacter sphaeroides GN=tspO PE=1 SV=1 37 175 3.0E-10
sp|P17057|CRTK_RHOCB Protein CrtK OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtK PE=3 SV=1 45 175 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 58 76 18
3 97 119 22
4 129 146 17
5 151 173 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5707
MTTYMPSITIPPAVLQHPAASVLLPVALGTAVGFGTRPSETQRTYRALKQPPLHPPPWLFGPVWTVLYGLMGYAS
YRVARAGLSPMAPPATAQTARHSLTLYTLQLGLNLAWMPLFFVAKRPVEATADIVALLGLNGYLAYLWSSVDCAA
ALCHLPYLGWLGFATYLCAGAGHLNGWDFSHLASARAKDDKEE*
Coding >Hirsu2|5707
ATGACGACGTACATGCCCAGCATCACCATCCCGCCGGCCGTGCTGCAGCACCCGGCCGCGTCCGTACTGCTGCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACGCGACCGTCCGAGACGCAGCGGACGTACCGCGCGCTCAAGCAG
CCGCCGCTGCACCCGCCGCCCTGGCTCTTCGGCCCCGTCTGGACGGTGCTGTACGGACTGATGGGCTACGCGTCG
TACCGCGTCGCCCGCGCCGGCCTGTCGCCGATGGCGCCGCCCGCGACGGCGCAGACGGCGCGCCACAGCCTGACG
CTCTACACCCTGCAGCTGGGCCTCAACCTGGCCTGGATGCCGCTCTTCTTCGTCGCCAAGCGGCCGGTCGAGGCT
ACGGCCGACATCGTCGCCCTGCTCGGCCTCAACGGCTACCTGGCCTACCTGTGGAGCTCCGTCGACTGCGCCGCC
GCCCTCTGCCACCTGCCCTACCTCGGCTGGCTGGGCTTCGCCACCTACCTGTGCGCCGGCGCCGGCCACCTCAAC
GGCTGGGACTTTTCCCACCTCGCCTCGGCCCGCGCCAAGGACGACAAGGAGGAATAG
Transcript >Hirsu2|5707
ATGACGACGTACATGCCCAGCATCACCATCCCGCCGGCCGTGCTGCAGCACCCGGCCGCGTCCGTACTGCTGCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACGCGACCGTCCGAGACGCAGCGGACGTACCGCGCGCTCAAGCAG
CCGCCGCTGCACCCGCCGCCCTGGCTCTTCGGCCCCGTCTGGACGGTGCTGTACGGACTGATGGGCTACGCGTCG
TACCGCGTCGCCCGCGCCGGCCTGTCGCCGATGGCGCCGCCCGCGACGGCGCAGACGGCGCGCCACAGCCTGACG
CTCTACACCCTGCAGCTGGGCCTCAACCTGGCCTGGATGCCGCTCTTCTTCGTCGCCAAGCGGCCGGTCGAGGCT
ACGGCCGACATCGTCGCCCTGCTCGGCCTCAACGGCTACCTGGCCTACCTGTGGAGCTCCGTCGACTGCGCCGCC
GCCCTCTGCCACCTGCCCTACCTCGGCTGGCTGGGCTTCGCCACCTACCTGTGCGCCGGCGCCGGCCACCTCAAC
GGCTGGGACTTTTCCCACCTCGCCTCGGCCCGCGCCAAGGACGACAAGGAGGAATAG
Gene >Hirsu2|5707
ATGACGACGTACATGCCCAGCATCACCATCCCGCCGGCCGTGCTGCAGCACCCGGCCGCGTCCGTACTGCTGCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACGCGACGTCAGAAAACCCCCTCTCCCGACCCGCGGCCTCGTCCA
CCGGCTGACACGGTCGCGCAGCGTCCGAGACGCAGCGGACGTACCGCGCGCTCAAGCAGCCGCCGCTGCACCCGC
CGCCCTGGCTCTTCGGCCCCGTCTGGACGGTGCTGTACGGGTGAGCTGGCCCGCGCCCCGGGGGGGAGAGGAGAA
GGAAGAGAAGAAAAAAAAAAGGGGGTGGGTGGAAGCGGCTGACGTTGTGTCTCGTCTTCGCTCGACGGGGATAGA
CTGATGGGCTACGCGTCGTACCGCGTCGCCCGCGCCGGCCTGTCGCCGATGGCGCCGCCCGCGACGGCGCAGACG
GCGCGCCACAGCCTGACGCTCTACACCCTGCAGCTGGGCCTCAACCTGGCCTGGATGCCGCTCTTCTTCGTCGCC
AAGCGGCCGGTCGAGGCTACGGCCGACATCGTCGCCCTGCTCGGCCTCAACGGCTACCTGGCCTACCTGTGGAGC
TCCGTCGACTGCGCCGCCGCCCTCTGCCACCTGCCCTACCTCGGCTGGCTGGGCTTCGCCACCTACCTGTGCGCC
GGCGCCGGCCACCTCAACGGCTGGGACTTTTCCCACCTCGCCTCGGCCCGCGCCAAGGACGACAAGGAGGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail