Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5701
Gene name
LocationContig_287:9630..11037
Strand-
Gene length (bp)1407
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 8.7E-04 10 40

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6046 0.4874 0.0876 0.0875 0.2689 0.0116 0.1577 0.3739 0.101 0.0481

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576
Ophiocordyceps camponoti-rufipedis Ophun1|7602
Ophiocordyceps kimflemingae Ophio5|2612
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673
Ophiocordyceps subramaniannii Hirsu2|5701 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5701
MTPASALDRSDDLLLCILDFLSFPDLLSMSMVNKHIHSLTEAHLYSTIETTWALGSTPPVTLLLRSILDRPQLSS
PIRSLRIVGNGFGHNFEVDEPLPCPLSTVSTNKASEIILSTGVPHTNLWINELQSGTVDAIVATLLITTANLKSL
YLGPNFTIKSRLIGSVFLYALCKPLQKYQLPTFQNLRQVTFSRRGREYFYREVNNTSDVLPFFYLPELQHLSISL
DNPYDFVWPAHTPTPSSLESLEIYRLREAGLMPLLQALKGLRLRKLHWHWFYQPDLDRHVSKDIIELDTIAKALN
QVHGTLTDLTIGAAARPAILGGDYEPPPLKIRGSLDGMVHLGKLRSLSIPWVFLMGFSPMEFFESSSTNLRNALS
PSLEVLTLTADLADNEQWEWEDDSIVSAVKSELESRTWPHSTCLRHIELPIPLGYGKITDELIQELRSIGANARL
DFGWTRASRAELFLKHSA*
Coding >Hirsu2|5701
ATGACGCCGGCGTCGGCTCTGGATCGGTCAGACGACTTGCTGCTTTGCATCTTGGACTTCCTGTCTTTCCCCGAC
CTACTCTCCATGAGTATGGTCAACAAACACATCCACTCTCTCACCGAGGCTCATCTCTACTCTACCATCGAGACG
ACTTGGGCTTTGGGCTCCACCCCGCCGGTCACGCTTCTGCTACGAAGCATCCTCGATAGACCCCAGCTGTCCAGT
CCTATCCGCAGTCTACGCATCGTCGGCAACGGCTTTGGGCACAATTTTGAAGTGGACGAGCCACTGCCGTGCCCT
CTTTCTACGGTCTCAACTAACAAAGCATCTGAGATCATCCTATCTACAGGAGTGCCACACACCAATCTCTGGATC
AATGAATTGCAATCTGGCACGGTGGACGCCATCGTGGCAACCCTCCTAATAACGACAGCTAACCTAAAATCCCTC
TATCTCGGCCCAAACTTTACCATCAAAAGCCGACTCATAGGATCGGTGTTTTTATACGCCTTATGCAAGCCGTTG
CAGAAATATCAGCTACCTACTTTCCAAAACCTCCGCCAAGTTACCTTCTCCCGCAGGGGGAGGGAATACTTCTAC
CGAGAGGTCAACAACACGTCTGATGTTCTCCCGTTCTTCTATCTCCCGGAGCTCCAACACCTTTCTATATCGCTT
GACAACCCATATGATTTCGTCTGGCCCGCACACACGCCAACCCCCTCCTCTCTCGAATCCCTGGAAATTTACCGG
CTACGGGAGGCGGGGCTGATGCCATTACTTCAGGCTCTGAAAGGACTCCGACTCCGGAAACTGCACTGGCACTGG
TTCTACCAGCCCGATCTCGACCGGCACGTAAGCAAAGACATCATTGAGCTTGATACGATAGCGAAAGCGCTGAAT
CAAGTTCATGGTACGCTTACGGACCTGACTATCGGGGCGGCCGCCCGTCCCGCCATCTTAGGCGGGGATTACGAG
CCCCCTCCGCTAAAAATCCGGGGTTCATTGGACGGCATGGTTCACCTAGGCAAGTTAAGAAGTCTGTCTATCCCA
TGGGTTTTCCTCATGGGATTCTCCCCCATGGAATTTTTCGAATCCTCGTCAACAAACCTGCGGAATGCGCTCTCT
CCAAGTCTTGAGGTGCTTACCCTAACGGCCGATTTGGCCGACAATGAGCAATGGGAGTGGGAGGATGATTCTATC
GTGTCTGCGGTCAAGTCCGAGCTGGAAAGTCGGACTTGGCCTCATTCAACCTGTCTACGCCACATAGAGTTGCCC
ATCCCCCTTGGATATGGAAAAATAACGGATGAACTAATACAAGAGCTGAGATCTATTGGCGCAAATGCACGGCTA
GACTTTGGATGGACCCGGGCATCTAGGGCGGAGCTATTTCTCAAGCATTCTGCTTAA
Transcript >Hirsu2|5701
ATGACGCCGGCGTCGGCTCTGGATCGGTCAGACGACTTGCTGCTTTGCATCTTGGACTTCCTGTCTTTCCCCGAC
CTACTCTCCATGAGTATGGTCAACAAACACATCCACTCTCTCACCGAGGCTCATCTCTACTCTACCATCGAGACG
ACTTGGGCTTTGGGCTCCACCCCGCCGGTCACGCTTCTGCTACGAAGCATCCTCGATAGACCCCAGCTGTCCAGT
CCTATCCGCAGTCTACGCATCGTCGGCAACGGCTTTGGGCACAATTTTGAAGTGGACGAGCCACTGCCGTGCCCT
CTTTCTACGGTCTCAACTAACAAAGCATCTGAGATCATCCTATCTACAGGAGTGCCACACACCAATCTCTGGATC
AATGAATTGCAATCTGGCACGGTGGACGCCATCGTGGCAACCCTCCTAATAACGACAGCTAACCTAAAATCCCTC
TATCTCGGCCCAAACTTTACCATCAAAAGCCGACTCATAGGATCGGTGTTTTTATACGCCTTATGCAAGCCGTTG
CAGAAATATCAGCTACCTACTTTCCAAAACCTCCGCCAAGTTACCTTCTCCCGCAGGGGGAGGGAATACTTCTAC
CGAGAGGTCAACAACACGTCTGATGTTCTCCCGTTCTTCTATCTCCCGGAGCTCCAACACCTTTCTATATCGCTT
GACAACCCATATGATTTCGTCTGGCCCGCACACACGCCAACCCCCTCCTCTCTCGAATCCCTGGAAATTTACCGG
CTACGGGAGGCGGGGCTGATGCCATTACTTCAGGCTCTGAAAGGACTCCGACTCCGGAAACTGCACTGGCACTGG
TTCTACCAGCCCGATCTCGACCGGCACGTAAGCAAAGACATCATTGAGCTTGATACGATAGCGAAAGCGCTGAAT
CAAGTTCATGGTACGCTTACGGACCTGACTATCGGGGCGGCCGCCCGTCCCGCCATCTTAGGCGGGGATTACGAG
CCCCCTCCGCTAAAAATCCGGGGTTCATTGGACGGCATGGTTCACCTAGGCAAGTTAAGAAGTCTGTCTATCCCA
TGGGTTTTCCTCATGGGATTCTCCCCCATGGAATTTTTCGAATCCTCGTCAACAAACCTGCGGAATGCGCTCTCT
CCAAGTCTTGAGGTGCTTACCCTAACGGCCGATTTGGCCGACAATGAGCAATGGGAGTGGGAGGATGATTCTATC
GTGTCTGCGGTCAAGTCCGAGCTGGAAAGTCGGACTTGGCCTCATTCAACCTGTCTACGCCACATAGAGTTGCCC
ATCCCCCTTGGATATGGAAAAATAACGGATGAACTAATACAAGAGCTGAGATCTATTGGCGCAAATGCACGGCTA
GACTTTGGATGGACCCGGGCATCTAGGGCGGAGCTATTTCTCAAGCATTCTGCTTAA
Gene >Hirsu2|5701
ATGACGCCGGCGTCGGCTCTGGATCGGTCAGACGACTTGCTGCTTTGCATCTTGGACTTCCTGTCTTTCCCCGAC
CTACTCTCCATGAGTATGGTCAACAAACACATCCACTCTCTCACCGAGGCTCATCTCTACTCTACCATCGAGACG
ACTTGGGCTTTGGGCTCCACCCCGCCGGTCACGCTTCTGCTACGAAGCATCCTCGATAGACCCCAGCTGTCCAGT
CCTATCCGCAGTCTACGCATCGTCGGCAACGGCTTTGGGCACAATTTTGAAGTGGACGAGCCACTGCCGTGCCCT
CTTTCTACGGTCTCAACTAACAAAGCATCTGAGATCATCCTATCTACAGGAGTGCCACACACCAATCTCTGGATC
AATGAATTGCAATCTGGCACGGTGGACGCCATCGTGGCAACCCTCCTAATAACGACAGCTAACCTAAAATCCCTC
TATCTCGGCCCAAACTTTACCATCAAAAGCCGACTCATAGGATCGGTGTTTTTATACGCCTTATGCAAGCCGTTG
CAGAAATATCAGCTACCTACTTTCCAAAACCTCCGCCAAGTTACCTTCTCCCGCAGGGGGAGGGAATACTTCTAC
CGAGAGGTCAACAACACGTCTGATGTTCTCCCGTTCTTCTATCTCCCGGAGCTCCAACACCTTTCTATATCGCTT
GACAACCCATATGATTTCGTCTGGCCCGCACACACGCCAACCCCCTCCTCTCTCGAATCCCTGGAAATTTACCGG
CTACGGGAGGCGGGGCTGATGCCATTACTTCAGGCTCTGAAAGGACTCCGACTCCGGAAACTGCACTGGCACTGG
TTCTACCAGCCCGATCTCGACCGGCACGTAAGCAAAGACATCATTGAGCTTGATACGATAGCGAAAGCGCTGAAT
CAAGTTCATGGTACGCTTACGGACCTGACTATCGGGGCGGCCGCCCGTCCCGCCATCTTAGGCGGGGATTACGAG
CCCCCTCCGCTAAAAATCCGGGGTTCATTGGACGGCATGGTTCACCTAGGCAAGTTAAGAAGTCTGTCTATCCCA
TGGGTTTTCCTCATGGGATTCTCCCCCATGGAATTTTTCGAATCCTCGTCAACAAACCTGCGGAATGCGCTCTCT
CCAAGTCTTGAGGTGCTTACCCTAACGGCCGATTTGGCCGACAATGAGCAATGGGAGTGGGAGGATGATTCTATC
GTGTCTGCGGTCAAGTCCGAGCTGGAAAGTCGGACTTGGCCTCATTCAACCTGTCTACGCCACATAGAGTTGCCC
ATCCCCCTTGGATATGGAAAAATAACGGATGAACTAATACAAGAGCTGAGATCTATTGGCGCAAATGCACGGCTA
GACTTTGGATGGACCCGGGCATCTAGGGCGGAGCTATTTCTCAAGCATTCTGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail