Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|570
Gene name
LocationContig_1110:5102..7580
Strand+
Gene length (bp)2478
Transcript length (bp)2202
Coding sequence length (bp)2202
Protein length (aa) 734

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 199 567 3.0E-09
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 199 569 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 275 294 19
2 305 327 22
3 334 353 19
4 373 395 22
5 402 424 22
6 429 446 17
7 459 481 22
8 517 539 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|570
MGDRRRRITLPPPPPPPPLNSSPAPDPERRPLLSRSQTDHGDRDDQMYSCMSDPHSHLPVYTNIHRIRRDITSVV
EDHLSLEQLRDVRINVTVVRPLVDKFYELGDISIIYCLLVNRAQFLMEESQSSNRQNVNWTRATLCELIATRILR
RFGEDHEGTDGLLLLAHILVAGFEPFQNAPLHIRDEAQAKTSWTHHRTLPSLEVAILTESKHFLSSSTCQRVVSA
IYEGRIIYTPSTMWDIIPDHYKLRPISVYDPRESPLLNQYRLIVPRTRNILEAIQFTILLALYIGLMLVKHNASV
TLVEIAFALYAFGWGLDQFATILAHGWDVYTQNLWSFLDVTFISIYLIYLMLRLHGLRLGDAGAPAPAFDVLALA
APVLVPRLAFTLLSDNLIFLSLRSMMADFFLLTALSAWCFFGFLLSLLWLGEGAHPIVTISKWMIYIWFGLDGTG
IQRSTEFHWLLGPCLMVAFAFLGNTLFLTILVSMLSNTFSNISTNATAEIQFRRAVLTLEGVKADAVFAYQPPFN
LLAVFLLLPLKFVVSPRWFHKTHVTLVRLVNLPLLLIIAVAERRLLWQSSETVHPPRKKRFWRKWRMSAHRYLRA
VFQVPPPDDVHDDIAVDDDLTHHLIRRQFTRQHTLAEAAPRKPSRRDSMFPGLSSKLRSSFTENSDDYGAMAAKI
VSMEKSMQRMEVMLAKLLPEGEAILDDSSSSSTDEIAESSTLREGDGLTIESSFKGQA*
Coding >Hirsu2|570
ATGGGGGATCGCAGGCGGCGCATCACCCTGCCGCCTCCTCCGCCGCCGCCGCCGCTGAACTCGTCTCCTGCTCCC
GATCCGGAGCGCCGTCCGCTGCTGAGCAGGTCCCAGACCGACCATGGCGACCGCGACGACCAGATGTACAGCTGC
ATGTCCGACCCCCATAGCCATCTGCCCGTCTACACCAACATCCACCGCATCCGCCGCGACATCACCAGCGTCGTC
GAGGACCATTTGAGCCTCGAGCAGTTGAGGGATGTCAGGATCAACGTCACCGTCGTGAGGCCCCTGGTCGACAAG
TTCTACGAGCTCGGCGACATCTCCATCATCTACTGCCTGCTGGTGAACCGCGCTCAGTTCTTGATGGAGGAGTCC
CAGTCGAGCAACCGGCAAAACGTCAACTGGACCCGCGCCACCCTGTGCGAGCTCATCGCCACCCGCATCCTCCGC
CGCTTCGGCGAAGACCACGAGGGCACCGACGGCCTGCTGCTGCTGGCCCACATCCTCGTCGCCGGCTTCGAGCCC
TTCCAGAACGCGCCCCTGCACATCCGCGATGAGGCCCAGGCCAAGACGTCTTGGACGCACCACCGCACCCTGCCC
TCGCTCGAGGTGGCCATCCTGACCGAGAGCAAGCACTTTCTCAGCTCCTCCACCTGCCAGCGCGTCGTCTCCGCC
ATCTACGAAGGCCGCATCATCTACACCCCATCTACCATGTGGGACATCATCCCCGACCACTACAAGCTCAGGCCC
ATCTCCGTCTACGACCCTCGCGAGTCGCCCCTACTCAACCAGTATCGACTCATCGTGCCCCGGACGCGCAACATC
CTCGAGGCCATCCAGTTCACCATCCTTCTCGCTCTCTACATCGGCCTCATGCTCGTCAAGCACAATGCCAGCGTC
ACCCTGGTCGAGATCGCTTTTGCCCTCTACGCCTTTGGCTGGGGACTGGACCAGTTTGCGACAATCTTGGCTCAC
GGCTGGGACGTCTATACTCAGAACTTGTGGTCCTTCCTCGACGTCACCTTCATCTCCATCTATCTCATCTACCTG
ATGCTGCGCCTGCATGGACTGCGCCTGGGTGACGCCGGCGCCCCGGCACCGGCGTTTGACGTTCTGGCGCTCGCC
GCCCCCGTCCTCGTCCCTCGCCTCGCCTTCACTCTCCTCTCGGACAACCTCATCTTCCTGTCCCTGCGATCCATG
ATGGCCGACTTCTTCCTCCTGACGGCGCTGTCGGCCTGGTGTTTCTTTGGCTTCTTGCTCTCCCTGCTGTGGCTG
GGCGAAGGAGCGCATCCCATCGTCACTATATCGAAGTGGATGATTTATATCTGGTTCGGCCTCGACGGCACCGGC
ATCCAGCGCTCGACCGAATTTCACTGGCTGCTGGGCCCCTGCCTCATGGTCGCATTTGCCTTCCTAGGCAACACC
CTCTTCCTCACCATCCTCGTCTCGATGCTGTCCAACACCTTCAGCAACATTTCCACCAACGCAACCGCCGAGATA
CAGTTCCGCCGCGCCGTGCTGACCCTCGAAGGCGTCAAGGCCGATGCCGTGTTTGCCTACCAGCCGCCCTTCAAC
CTCCTGGCCGTCTTTCTGCTCTTGCCGCTCAAGTTTGTCGTCAGCCCGCGTTGGTTCCACAAGACTCACGTCACC
CTCGTGCGCCTGGTCAACCTTCCCCTTCTCCTCATCATCGCCGTTGCCGAGCGTCGTCTGCTCTGGCAGTCCAGC
GAGACGGTCCACCCGCCGCGCAAGAAGCGATTCTGGCGCAAGTGGCGGATGTCGGCGCACAGGTACCTGCGCGCC
GTCTTCCAGGTGCCGCCGCCCGACGACGTGCACGACGACATCGCCGTCGACGACGACCTGACGCACCACCTCATC
CGGCGGCAATTCACCCGGCAGCACACGCTGGCGGAGGCGGCGCCACGGAAGCCGTCGCGCAGGGACTCCATGTTC
CCCGGCCTGTCAAGCAAGCTGCGCAGCTCCTTCACCGAGAACAGCGATGACTACGGGGCCATGGCGGCCAAGATT
GTGTCGATGGAGAAGTCGATGCAGCGCATGGAGGTTATGCTGGCGAAGCTGTTACCGGAGGGCGAGGCCATCTTG
GACGACTCTTCCTCCTCCTCGACCGACGAGATTGCAGAGAGCAGCACTCTGAGGGAGGGAGATGGGCTCACGATC
GAGTCTTCATTCAAGGGCCAGGCGTGA
Transcript >Hirsu2|570
ATGGGGGATCGCAGGCGGCGCATCACCCTGCCGCCTCCTCCGCCGCCGCCGCCGCTGAACTCGTCTCCTGCTCCC
GATCCGGAGCGCCGTCCGCTGCTGAGCAGGTCCCAGACCGACCATGGCGACCGCGACGACCAGATGTACAGCTGC
ATGTCCGACCCCCATAGCCATCTGCCCGTCTACACCAACATCCACCGCATCCGCCGCGACATCACCAGCGTCGTC
GAGGACCATTTGAGCCTCGAGCAGTTGAGGGATGTCAGGATCAACGTCACCGTCGTGAGGCCCCTGGTCGACAAG
TTCTACGAGCTCGGCGACATCTCCATCATCTACTGCCTGCTGGTGAACCGCGCTCAGTTCTTGATGGAGGAGTCC
CAGTCGAGCAACCGGCAAAACGTCAACTGGACCCGCGCCACCCTGTGCGAGCTCATCGCCACCCGCATCCTCCGC
CGCTTCGGCGAAGACCACGAGGGCACCGACGGCCTGCTGCTGCTGGCCCACATCCTCGTCGCCGGCTTCGAGCCC
TTCCAGAACGCGCCCCTGCACATCCGCGATGAGGCCCAGGCCAAGACGTCTTGGACGCACCACCGCACCCTGCCC
TCGCTCGAGGTGGCCATCCTGACCGAGAGCAAGCACTTTCTCAGCTCCTCCACCTGCCAGCGCGTCGTCTCCGCC
ATCTACGAAGGCCGCATCATCTACACCCCATCTACCATGTGGGACATCATCCCCGACCACTACAAGCTCAGGCCC
ATCTCCGTCTACGACCCTCGCGAGTCGCCCCTACTCAACCAGTATCGACTCATCGTGCCCCGGACGCGCAACATC
CTCGAGGCCATCCAGTTCACCATCCTTCTCGCTCTCTACATCGGCCTCATGCTCGTCAAGCACAATGCCAGCGTC
ACCCTGGTCGAGATCGCTTTTGCCCTCTACGCCTTTGGCTGGGGACTGGACCAGTTTGCGACAATCTTGGCTCAC
GGCTGGGACGTCTATACTCAGAACTTGTGGTCCTTCCTCGACGTCACCTTCATCTCCATCTATCTCATCTACCTG
ATGCTGCGCCTGCATGGACTGCGCCTGGGTGACGCCGGCGCCCCGGCACCGGCGTTTGACGTTCTGGCGCTCGCC
GCCCCCGTCCTCGTCCCTCGCCTCGCCTTCACTCTCCTCTCGGACAACCTCATCTTCCTGTCCCTGCGATCCATG
ATGGCCGACTTCTTCCTCCTGACGGCGCTGTCGGCCTGGTGTTTCTTTGGCTTCTTGCTCTCCCTGCTGTGGCTG
GGCGAAGGAGCGCATCCCATCGTCACTATATCGAAGTGGATGATTTATATCTGGTTCGGCCTCGACGGCACCGGC
ATCCAGCGCTCGACCGAATTTCACTGGCTGCTGGGCCCCTGCCTCATGGTCGCATTTGCCTTCCTAGGCAACACC
CTCTTCCTCACCATCCTCGTCTCGATGCTGTCCAACACCTTCAGCAACATTTCCACCAACGCAACCGCCGAGATA
CAGTTCCGCCGCGCCGTGCTGACCCTCGAAGGCGTCAAGGCCGATGCCGTGTTTGCCTACCAGCCGCCCTTCAAC
CTCCTGGCCGTCTTTCTGCTCTTGCCGCTCAAGTTTGTCGTCAGCCCGCGTTGGTTCCACAAGACTCACGTCACC
CTCGTGCGCCTGGTCAACCTTCCCCTTCTCCTCATCATCGCCGTTGCCGAGCGTCGTCTGCTCTGGCAGTCCAGC
GAGACGGTCCACCCGCCGCGCAAGAAGCGATTCTGGCGCAAGTGGCGGATGTCGGCGCACAGGTACCTGCGCGCC
GTCTTCCAGGTGCCGCCGCCCGACGACGTGCACGACGACATCGCCGTCGACGACGACCTGACGCACCACCTCATC
CGGCGGCAATTCACCCGGCAGCACACGCTGGCGGAGGCGGCGCCACGGAAGCCGTCGCGCAGGGACTCCATGTTC
CCCGGCCTGTCAAGCAAGCTGCGCAGCTCCTTCACCGAGAACAGCGATGACTACGGGGCCATGGCGGCCAAGATT
GTGTCGATGGAGAAGTCGATGCAGCGCATGGAGGTTATGCTGGCGAAGCTGTTACCGGAGGGCGAGGCCATCTTG
GACGACTCTTCCTCCTCCTCGACCGACGAGATTGCAGAGAGCAGCACTCTGAGGGAGGGAGATGGGCTCACGATC
GAGTCTTCATTCAAGGGCCAGGCGTGA
Gene >Hirsu2|570
ATGGGGGATCGCAGGCGGCGCATCACCCTGCCGCCTCCTCCGCCGCCGCCGCCGCTGAACTCGTCTCCTGCTCCC
GATCCGGAGCGCCGTCCGCTGCTGAGCAGGTCCCAGACCGACCATGGCGACCGCGACGACCAGATGTACAGCTGC
ATGTCCGACCCCCATAGCCATCTGCCCGTCTACACCAACATCCACCGCATCCGCCGCGACATCACCAGCGTCGTC
GAGGACCATTTGAGCCTCGAGCAGTTGAGGGATGTCAGGATCAACGTCACCGTCGTGAGGCCCCTGGTCGACAAG
TTCTACGAGCTCGGCGACATCTCCATCAGTGAGTCCCCCCGTCCGCGCGCGCGCCCTCGTCTGGGCTGTTTGCTG
ACGACGTCCTTGCTCGCGCAGTCTACTGCCTGCTGGTGAACCGCGCTCAGTTCTTGATGGAGGAGTCCCAGTCGA
GCAACCGGCAAAACGTCAACTGGACCCGCGCCACCCTGTGCGAGCTCATCGCCACCCGCATCCTCCGCCGCTTCG
GCGAAGACCACGAGGGCACCGACGGCCTGCTGCTGCTGGCCCACATCCTCGTCGCCGGCTTCGAGCCCTTCCAGA
ACGCGCCCCTGCACATCCGCGATGAGGCCCAGGCCAAGACGTCTTGGACGCACCACCGCACCCTGCCCTCGCTCG
AGGTGGCCATCCTGACCGAGAGCAAGCACTTTCTCAGCTCCTCCACCTGCCAGCGCGTCGTCTCCGCCATCTACG
AAGGCCGCATCATCTACACCCCATCTACCATGTGGGACATCATCCCCGACCACTACAAGCTCAGGCCCATCTCCG
TCTACGACCCTCGCGAGTCGCCCCTACTCAACCAGTATCGACTCATCGTGCCCCGGACGCGCAACATCCTCGAGG
CCATCCAGTTCACCATCCTTCTCGCTCTCTACATCGGCCTCATGCTCGTCAAGCACAATGCCAGCGTCACCCTGG
TCGAGATCGCTTTTGCCCTCTACGCCTTTGGCTGGGGACTGGACCAGTTTGCGACAATCTTGGCTCACGGCTGGT
CAGTCTTGATGCCCCGGCCCCCTCTCCCCTCCATCCCGAGCTGGCCGCCCCCGCTGACCGTCTCGTATCAGGGAC
GTCTATACTCAGAACTTGTGGTCCTTCCTCGACGTCACCTTCATCTCCATCTATCTCATCTACCTGATGCTGCGC
CTGCATGGACTGCGCCTGGGTGACGCCGGCGCCCCGGCACCGGCGTTTGACGTTCTGGCGCTCGCCGCCCCCGTC
CTCGTCCCTCGCCTCGCCTTCACTCTCCTCTCGGACAACCTCATCTTCCTGTCCCTGCGATCCATGATGGCCGAC
TTCTTCCTCCTGACGGCGCTGTCGGCCTGGTGTTTCTTTGGCTTCTTGCTCTCCCTGCTGTGGCTGGGCGAAGGA
GCGCATCCCATCGTGTAAGTCCAGAGGGGCCGTCCCCGGCCGCCAGCCACAGACACGGGCTGACCCCGAGCAGCA
CTATATCGAAGTGGATGATTTATATCTGGTTCGGCCTCGACGGCACCGGCATCCAGCGCTCGGTAAGCATCCCGC
CATCGTCGGCATCGCCCGCATCACGACGTCTAACCTGTCCCCGTCTACGCGCGCGCGTCGCAGACCGAATTTCAC
TGGCTGCTGGGCCCCTGCCTCATGGTCGCATTTGCCTTCCTAGGCAACACCCTCTTCCTCACCATCCTCGTCTCG
ATGCTGTCCAACACCTTCAGCAACATTTCCACCAACGCAACCGCCGAGATACAGTTCCGCCGCGCCGTGCTGACC
CTCGAAGGCGTCAAGGCCGATGCCGTGTTTGCCTACCAGCCGCCCTTCAACCTCCTGGCCGTCTTTCTGCTCTTG
CCGCTCAAGTTTGTCGTCAGCCCGCGTTGGTTCCACAAGACTCACGTCACCCTCGTGCGCCTGGTCAACCTTCCC
CTTCTCCTCATCATCGCCGTTGCCGAGCGTCGTCTGCTCTGGCAGTCCAGCGAGACGGTCCACCCGCCGCGCAAG
AAGCGATTCTGGCGCAAGTGGCGGATGTCGGCGCACAGGTACCTGCGCGCCGTCTTCCAGGTGCCGCCGCCCGAC
GACGTGCACGACGACATCGCCGTCGACGACGACCTGACGCACCACCTCATCCGGCGGCAATTCACCCGGCAGCAC
ACGCTGGCGGAGGCGGCGCCACGGAAGCCGTCGCGCAGGGACTCCATGTTCCCCGGCCTGTCAAGCAAGCTGCGC
AGCTCCTTCACCGAGAACAGCGATGACTACGGGGCCATGGCGGCCAAGATTGTGTCGATGGAGAAGTCGATGCAG
CGCATGGAGGTTATGCTGGCGAAGCTGTTACCGGAGGGCGAGGCCATCTTGGACGACTCTTCCTCCTCCTCGACC
GACGAGATTGCAGAGAGCAGCACTCTGAGGGAGGGAGATGGGCTCACGATCGAGTCTTCATTCAAGGGCCAGGCG
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail