Protein ID | Hirsu2|5697 |
Gene name | |
Location | Contig_2867:258..1406 |
Strand | - |
Gene length (bp) | 1148 |
Transcript length (bp) | 1074 |
Coding sequence length (bp) | 1074 |
Protein length (aa) | 358 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01218 | Coprogen_oxidas | Coproporphyrinogen III oxidase | 4.2E-146 | 53 | 356 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P11353|HEM6_YEAST | Oxygen-dependent coproporphyrinogen-III oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM13 PE=1 SV=2 | 47 | 357 | 2.0E-133 |
sp|Q9V3D2|HEM6_DROME | Oxygen-dependent coproporphyrinogen-III oxidase OS=Drosophila melanogaster GN=Coprox PE=1 SV=1 | 44 | 357 | 2.0E-132 |
sp|Q9UTE2|HEM6_SCHPO | Probable oxygen-dependent coproporphyrinogen-III oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem13 PE=3 SV=1 | 49 | 356 | 1.0E-129 |
sp|P36551|HEM6_HUMAN | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens GN=CPOX PE=1 SV=3 | 50 | 357 | 1.0E-128 |
sp|P36552|HEM6_MOUSE | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Mus musculus GN=Cpox PE=1 SV=2 | 50 | 357 | 2.0E-127 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P11353|HEM6_YEAST | Oxygen-dependent coproporphyrinogen-III oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM13 PE=1 SV=2 | 47 | 357 | 2.0E-133 |
sp|Q9V3D2|HEM6_DROME | Oxygen-dependent coproporphyrinogen-III oxidase OS=Drosophila melanogaster GN=Coprox PE=1 SV=1 | 44 | 357 | 2.0E-132 |
sp|Q9UTE2|HEM6_SCHPO | Probable oxygen-dependent coproporphyrinogen-III oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem13 PE=3 SV=1 | 49 | 356 | 1.0E-129 |
sp|P36551|HEM6_HUMAN | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens GN=CPOX PE=1 SV=3 | 50 | 357 | 1.0E-128 |
sp|P36552|HEM6_MOUSE | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Mus musculus GN=Cpox PE=1 SV=2 | 50 | 357 | 2.0E-127 |
sp|Q3B7D0|HEM6_RAT | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Rattus norvegicus GN=Cpox PE=1 SV=1 | 50 | 357 | 4.0E-127 |
sp|P35055|HEM6_SOYBN | Oxygen-dependent coproporphyrinogen-III oxidase, chloroplastic OS=Glycine max GN=CPX PE=2 SV=1 | 47 | 357 | 1.0E-122 |
sp|Q42946|HEM6_TOBAC | Oxygen-dependent coproporphyrinogen-III oxidase, chloroplastic OS=Nicotiana tabacum GN=CPX PE=2 SV=1 | 51 | 357 | 4.0E-119 |
sp|Q7XPL2|HEM6_ORYSJ | Oxygen-dependent coproporphyrinogen-III oxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=CPX PE=2 SV=2 | 14 | 357 | 3.0E-118 |
sp|Q9LR75|HEM61_ARATH | Coproporphyrinogen-III oxidase 1, chloroplastic OS=Arabidopsis thaliana GN=CPX1 PE=2 SV=1 | 50 | 357 | 9.0E-118 |
sp|Q42840|HEM6_HORVU | Oxygen-dependent coproporphyrinogen-III oxidase, chloroplastic OS=Hordeum vulgare GN=CPX PE=2 SV=1 | 40 | 357 | 1.0E-112 |
sp|Q8YX58|HEM62_NOSS1 | Coproporphyrinogen-III oxidase, aerobic 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemF2 PE=3 SV=1 | 51 | 357 | 4.0E-106 |
sp|Q7NEK3|HEM6_GLOVI | Oxygen-dependent coproporphyrinogen-III oxidase OS=Gloeobacter violaceus (strain PCC 7421) GN=hemF PE=3 SV=1 | 65 | 357 | 2.0E-105 |
sp|Q5N3S5|HEM6_SYNP6 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hemF PE=3 SV=1 | 51 | 357 | 2.0E-103 |
sp|Q8DL15|HEM6_THEEB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemF PE=3 SV=2 | 48 | 357 | 2.0E-101 |
sp|Q8YZ37|HEM61_NOSS1 | Coproporphyrinogen-III oxidase, aerobic 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemF1 PE=3 SV=1 | 58 | 356 | 4.0E-101 |
sp|Q82TL0|HEM6_NITEU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemF PE=3 SV=1 | 53 | 357 | 9.0E-99 |
sp|Q1H4H0|HEM6_METFK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemF PE=3 SV=1 | 57 | 357 | 1.0E-96 |
sp|P72848|HEM6_SYNY3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemF PE=1 SV=1 | 51 | 357 | 1.0E-96 |
sp|Q0AEP6|HEM6_NITEC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Nitrosomonas eutropha (strain C91) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-95 |
sp|Q5NFZ8|HEM6_FRATT | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-94 |
sp|Q14HF0|HEM6_FRAT1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-94 |
sp|A4IY09|HEM6_FRATW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-94 |
sp|B2SGG9|HEM6_FRATM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-94 |
sp|Q7W7U0|HEM6_BORPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-94 |
sp|Q7WL80|HEM6_BORBR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-94 |
sp|Q7VWE7|HEM6_BORPE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemF PE=3 SV=1 | 54 | 357 | 4.0E-94 |
sp|B7N626|HEM6_ECOLU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hemF PE=3 SV=1 | 53 | 357 | 8.0E-94 |
sp|A0Q6H6|HEM6_FRATN | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-93 |
sp|B7LKJ9|HEM6_ESCF3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-93 |
sp|Q0BLZ2|HEM6_FRATO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemF PE=3 SV=1 | 53 | 357 | 5.0E-93 |
sp|Q2A3H9|HEM6_FRATH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-93 |
sp|Q8FFA3|HEM6_ECOL6 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hemF PE=3 SV=2 | 53 | 357 | 7.0E-93 |
sp|Q0TF33|HEM6_ECOL5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-93 |
sp|A1ADV0|HEM6_ECOK1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O1:K1 / APEC GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-93 |
sp|B7MY86|HEM6_ECO81 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O81 (strain ED1a) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-93 |
sp|B7MHT7|HEM6_ECO45 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-93 |
sp|B7UGD5|HEM6_ECO27 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-93 |
sp|B1LMN0|HEM6_ECOSM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hemF PE=3 SV=1 | 53 | 357 | 8.0E-93 |
sp|Q32DB7|HEM6_SHIDS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|P36553|HEM6_ECOLI | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain K12) GN=hemF PE=1 SV=1 | 53 | 357 | 1.0E-92 |
sp|B1IWM6|HEM6_ECOLC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|A8A2T4|HEM6_ECOHS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O9:H4 (strain HS) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|B1XAA7|HEM6_ECODH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain K12 / DH10B) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|C4ZX09|HEM6_ECOBW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|Q0T273|HEM6_SHIF8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella flexneri serotype 5b (strain 8401) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-92 |
sp|B7NPX2|HEM6_ECO7I | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-92 |
sp|Q3YZA7|HEM6_SHISS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella sonnei (strain Ss046) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-92 |
sp|Q31Y44|HEM6_SHIBS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella boydii serotype 4 (strain Sb227) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-92 |
sp|B7M6U5|HEM6_ECO8A | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O8 (strain IAI1) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-92 |
sp|A7ZPN6|HEM6_ECO24 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-92 |
sp|A7NC51|HEM6_FRATF | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-92 |
sp|Q83QN1|HEM6_SHIFL | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella flexneri GN=hemF PE=3 SV=1 | 53 | 356 | 7.0E-92 |
sp|A2C524|HEM6_PROM1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain NATL1A) GN=hemF PE=3 SV=1 | 51 | 356 | 9.0E-92 |
sp|Q0I0R6|HEM6_SHESR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella sp. (strain MR-7) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-91 |
sp|Q0HPA0|HEM6_SHESM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella sp. (strain MR-4) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-91 |
sp|B0U151|HEM6_FRAP2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-91 |
sp|B7LCI0|HEM6_ECO55 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain 55989 / EAEC) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-91 |
sp|Q46IN4|HEM6_PROMT | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain NATL2A) GN=hemF PE=3 SV=1 | 51 | 356 | 5.0E-91 |
sp|A0KR67|HEM6_SHESA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella sp. (strain ANA-3) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-91 |
sp|B2TX24|HEM6_SHIB3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-91 |
sp|A9AJJ8|HEM6_BURM1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-91 |
sp|A7MKX5|HEM6_CROS8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemF PE=3 SV=1 | 48 | 357 | 7.0E-91 |
sp|C6D9M5|HEM6_PECCP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-90 |
sp|Q479T3|HEM6_DECAR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Dechloromonas aromatica (strain RCB) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-90 |
sp|B8E3K7|HEM6_SHEB2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella baltica (strain OS223) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-90 |
sp|A4WD41|HEM6_ENT38 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Enterobacter sp. (strain 638) GN=hemF PE=3 SV=1 | 49 | 357 | 5.0E-90 |
sp|A6WHB7|HEM6_SHEB8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella baltica (strain OS185) GN=hemF PE=3 SV=1 | 54 | 357 | 8.0E-90 |
sp|A3CYL1|HEM6_SHEB5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=hemF PE=3 SV=1 | 54 | 357 | 8.0E-90 |
sp|A9ITM7|HEM6_BORPD | Oxygen-dependent coproporphyrinogen-III oxidase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-90 |
sp|A8FP82|HEM6_SHESH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella sediminis (strain HAW-EB3) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-90 |
sp|A8ADF0|HEM6_CITK8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hemF PE=3 SV=1 | 49 | 357 | 1.0E-89 |
sp|Q39E99|HEM6_BURL3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-89 |
sp|A9KC01|HEM6_COXBN | Oxygen-dependent coproporphyrinogen-III oxidase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemF PE=3 SV=1 | 57 | 357 | 2.0E-89 |
sp|Q8EKQ2|HEM6_SHEON | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella oneidensis (strain MR-1) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-89 |
sp|B1JW43|HEM6_BURCC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia cenocepacia (strain MC0-3) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-89 |
sp|B4E5R8|HEM6_BURCJ | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-89 |
sp|Q7V568|HEM6_PROMM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemF PE=3 SV=1 | 43 | 356 | 5.0E-89 |
sp|A1V2G0|HEM6_BURMS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia mallei (strain SAVP1) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|Q62II8|HEM6_BURMA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia mallei (strain ATCC 23344) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|A2S4B5|HEM6_BURM9 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia mallei (strain NCTC 10229) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|A3MI45|HEM6_BURM7 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia mallei (strain NCTC 10247) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|Q63VT1|HEM6_BURPS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia pseudomallei (strain K96243) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|A3N7F7|HEM6_BURP6 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia pseudomallei (strain 668) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|A3NT46|HEM6_BURP0 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia pseudomallei (strain 1106a) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-89 |
sp|B8GTF9|HEM6_THISH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemF PE=3 SV=1 | 57 | 357 | 7.0E-89 |
sp|A1RDY8|HEM6_SHESW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella sp. (strain W3-18-1) GN=hemF PE=3 SV=1 | 54 | 357 | 7.0E-89 |
sp|A4Y1D3|HEM6_SHEPC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=hemF PE=3 SV=1 | 54 | 357 | 7.0E-89 |
sp|A9MID0|HEM6_SALAR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-88 |
sp|B1KCX1|HEM6_SHEWM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-88 |
sp|B5R4G0|HEM6_SALEP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella enteritidis PT4 (strain P125109) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-88 |
sp|Q7P012|HEM6_CHRVO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemF PE=3 SV=1 | 47 | 357 | 1.0E-88 |
sp|Q83AZ6|HEM6_COXBU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemF PE=3 SV=1 | 57 | 357 | 2.0E-88 |
sp|B5RCS3|HEM6_SALG2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-88 |
sp|B5FQE4|HEM6_SALDC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella dublin (strain CT_02021853) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-88 |
sp|B5BB50|HEM6_SALPK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella paratyphi A (strain AKU_12601) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-88 |
sp|Q5PI28|HEM6_SALPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-88 |
sp|B5YZY1|HEM6_ECO5E | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-88 |
sp|Q8XBI4|HEM6_ECO57 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli O157:H7 GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-88 |
sp|B4T0I0|HEM6_SALNS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella newport (strain SL254) GN=hemF PE=3 SV=1 | 54 | 357 | 4.0E-88 |
sp|B5F0I0|HEM6_SALA4 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella agona (strain SL483) GN=hemF PE=3 SV=1 | 54 | 357 | 4.0E-88 |
sp|Q12C42|HEM6_POLSJ | Oxygen-dependent coproporphyrinogen-III oxidase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hemF PE=3 SV=1 | 54 | 357 | 4.0E-88 |
sp|B5XVR1|HEM6_KLEP3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Klebsiella pneumoniae (strain 342) GN=hemF PE=3 SV=1 | 49 | 357 | 4.0E-88 |
sp|Q8Z4U8|HEM6_SALTI | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella typhi GN=hemF PE=3 SV=1 | 54 | 357 | 4.0E-88 |
sp|A9NA93|HEM6_COXBR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=hemF PE=3 SV=1 | 57 | 357 | 5.0E-88 |
sp|Q7V9T7|HEM6_PROMA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hemF PE=3 SV=1 | 51 | 356 | 7.0E-88 |
sp|Q0BD83|HEM6_BURCM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hemF PE=3 SV=1 | 53 | 357 | 9.0E-88 |
sp|B0TLD7|HEM6_SHEHH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=hemF PE=3 SV=1 | 47 | 357 | 9.0E-88 |
sp|B4TR28|HEM6_SALSV | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella schwarzengrund (strain CVM19633) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-87 |
sp|Q318G0|HEM6_PROM9 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemF PE=3 SV=1 | 51 | 357 | 1.0E-87 |
sp|Q6D8U8|HEM6_PECAS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-87 |
sp|B1YU52|HEM6_BURA4 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia ambifaria (strain MC40-6) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-87 |
sp|Q12T99|HEM6_SHEDO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-87 |
sp|A1S1K6|HEM6_SHEAM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=hemF PE=3 SV=1 | 49 | 357 | 3.0E-87 |
sp|C0PZ88|HEM6_SALPC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella paratyphi C (strain RKS4594) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-87 |
sp|Q57LQ6|HEM6_SALCH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella choleraesuis (strain SC-B67) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-87 |
sp|A9N336|HEM6_SALPB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-87 |
sp|B6I512|HEM6_ECOSE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Escherichia coli (strain SE11) GN=hemF PE=3 SV=1 | 53 | 357 | 5.0E-87 |
sp|B4EZS7|HEM6_PROMH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Proteus mirabilis (strain HI4320) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-87 |
sp|Q21PU0|HEM6_SACD2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-87 |
sp|Q5QXJ4|HEM6_IDILO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemF PE=3 SV=1 | 53 | 357 | 9.0E-87 |
sp|P33771|HEM6_SALTY | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-87 |
sp|B4TCI1|HEM6_SALHS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Salmonella heidelberg (strain SL476) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-87 |
sp|A8GHH2|HEM6_SERP5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Serratia proteamaculans (strain 568) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-86 |
sp|Q0VTD7|HEM6_ALCBS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hemF PE=3 SV=1 | 77 | 357 | 1.0E-86 |
sp|Q1I2G6|HEM6_PSEE4 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas entomophila (strain L48) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-86 |
sp|Q88RQ6|HEM6_PSEPK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas putida (strain KT2440) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-86 |
sp|Q7U4M7|HEM6_SYNPX | Oxygen-dependent coproporphyrinogen-III oxidase OS=Synechococcus sp. (strain WH8102) GN=hemF PE=3 SV=2 | 51 | 357 | 4.0E-86 |
sp|A2BYW5|HEM6_PROM5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemF PE=3 SV=1 | 51 | 356 | 5.0E-86 |
sp|B0KF35|HEM6_PSEPG | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas putida (strain GB-1) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-86 |
sp|Q7N6Z9|HEM6_PHOLL | Oxygen-dependent coproporphyrinogen-III oxidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hemF PE=3 SV=1 | 47 | 357 | 6.0E-86 |
sp|A2BTG1|HEM6_PROMS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain AS9601) GN=hemF PE=3 SV=1 | 51 | 356 | 6.0E-86 |
sp|Q3BMT4|HEM6_XANC5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hemF PE=3 SV=1 | 53 | 357 | 8.0E-86 |
sp|B2FND0|HEM6_STRMK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Stenotrophomonas maltophilia (strain K279a) GN=hemF PE=3 SV=1 | 53 | 357 | 8.0E-86 |
sp|C5CLQ3|HEM6_VARPS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Variovorax paradoxus (strain S110) GN=hemF PE=3 SV=1 | 37 | 357 | 9.0E-86 |
sp|A3PF71|HEM6_PROM0 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemF PE=3 SV=1 | 51 | 357 | 1.0E-85 |
sp|A5VWK4|HEM6_PSEP1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-85 |
sp|A8GYI0|HEM6_SHEPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hemF PE=3 SV=1 | 47 | 357 | 1.0E-85 |
sp|Q3AMK3|HEM6_SYNSC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Synechococcus sp. (strain CC9605) GN=hemF PE=3 SV=1 | 39 | 357 | 1.0E-85 |
sp|A6TC68|HEM6_KLEP7 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hemF PE=3 SV=1 | 49 | 357 | 2.0E-85 |
sp|Q603L4|HEM6_METCA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hemF PE=3 SV=1 | 77 | 357 | 2.0E-85 |
sp|Q1QTJ9|HEM6_CHRSD | Oxygen-dependent coproporphyrinogen-III oxidase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hemF PE=3 SV=1 | 77 | 357 | 2.0E-85 |
sp|B1JSJ6|HEM6_YERPY | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|Q668I6|HEM6_YERPS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|A4TMK2|HEM6_YERPP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pestis (strain Pestoides F) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|Q1CJZ7|HEM6_YERPN | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|A9QZK6|HEM6_YERPG | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|Q8ZCF9|HEM6_YERPE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pestis GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|B2K962|HEM6_YERPB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|Q1C5T7|HEM6_YERPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-85 |
sp|B4SNL7|HEM6_STRM5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-85 |
sp|Q2NS88|HEM6_SODGM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Sodalis glossinidius (strain morsitans) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-85 |
sp|Q8PF76|HEM6_XANAC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hemF PE=3 SV=1 | 53 | 357 | 3.0E-85 |
sp|Q3AWA8|HEM6_SYNS9 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Synechococcus sp. (strain CC9902) GN=hemF PE=3 SV=1 | 51 | 357 | 3.0E-85 |
sp|A7FG82|HEM6_YERP3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hemF PE=3 SV=1 | 47 | 357 | 4.0E-85 |
sp|Q5GUY0|HEM6_XANOR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-85 |
sp|B2SK75|HEM6_XANOP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-85 |
sp|Q2NY70|HEM6_XANOM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hemF PE=3 SV=1 | 53 | 357 | 4.0E-85 |
sp|B1J4A2|HEM6_PSEPW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas putida (strain W619) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-85 |
sp|Q8P3Q0|HEM6_XANCP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-85 |
sp|Q4UP76|HEM6_XANC8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hemF PE=3 SV=1 | 53 | 357 | 6.0E-85 |
sp|Q5WX75|HEM6_LEGPL | Oxygen-dependent coproporphyrinogen-III oxidase OS=Legionella pneumophila (strain Lens) GN=hemF PE=3 SV=1 | 53 | 357 | 7.0E-85 |
sp|P43898|HEM6_PSEAE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-85 |
sp|Q02V57|HEM6_PSEAB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hemF PE=3 SV=1 | 54 | 357 | 9.0E-85 |
sp|B0RYP5|HEM6_XANCB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hemF PE=3 SV=1 | 53 | 357 | 9.0E-85 |
sp|B7V0Q9|HEM6_PSEA8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas aeruginosa (strain LESB58) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-84 |
sp|B8CHB9|HEM6_SHEPW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-84 |
sp|Q5X5U7|HEM6_LEGPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Legionella pneumophila (strain Paris) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-84 |
sp|Q3KKE0|HEM6_PSEPF | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-84 |
sp|A4XNB8|HEM6_PSEMY | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas mendocina (strain ymp) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-84 |
sp|Q8XXC3|HEM6_RALSO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Ralstonia solanacearum (strain GMI1000) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-84 |
sp|Q142L8|HEM6_BURXL | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia xenovorans (strain LB400) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-84 |
sp|Q5ZW72|HEM6_LEGPH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemF PE=3 SV=2 | 53 | 357 | 2.0E-84 |
sp|A5IBB3|HEM6_LEGPC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Legionella pneumophila (strain Corby) GN=hemF PE=3 SV=1 | 53 | 357 | 2.0E-84 |
sp|A6UX86|HEM6_PSEA7 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas aeruginosa (strain PA7) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-84 |
sp|A8G786|HEM6_PROM2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemF PE=3 SV=1 | 51 | 357 | 3.0E-84 |
sp|B2T2A3|HEM6_BURPP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemF PE=3 SV=1 | 54 | 357 | 3.0E-84 |
sp|Q9PHC7|HEM6_XYLFA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xylella fastidiosa (strain 9a5c) GN=hemF PE=3 SV=2 | 53 | 357 | 4.0E-84 |
sp|Q48QH6|HEM6_PSE14 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-84 |
sp|A1VN15|HEM6_POLNA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Polaromonas naphthalenivorans (strain CJ2) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-84 |
sp|Q500S4|HEM6_PSEU2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hemF PE=3 SV=1 | 54 | 357 | 7.0E-84 |
sp|Q6LLK0|HEM6_PHOPR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Photobacterium profundum GN=hemF PE=3 SV=1 | 54 | 356 | 1.0E-83 |
sp|C3K4I0|HEM6_PSEFS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas fluorescens (strain SBW25) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-83 |
sp|Q88B49|HEM6_PSESM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-83 |
sp|Q4KKQ4|HEM6_PSEF5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hemF PE=3 SV=1 | 54 | 357 | 5.0E-83 |
sp|Q9KVT4|HEM6_VIBCH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hemF PE=3 SV=1 | 54 | 356 | 5.0E-83 |
sp|A5F4C4|HEM6_VIBC3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hemF PE=3 SV=1 | 54 | 356 | 5.0E-83 |
sp|Q7UZS3|HEM6_PROMP | Oxygen-dependent coproporphyrinogen-III oxidase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemF PE=3 SV=1 | 51 | 356 | 7.0E-83 |
sp|B0U1G5|HEM6_XYLFM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xylella fastidiosa (strain M12) GN=hemF PE=3 SV=1 | 53 | 357 | 1.0E-82 |
sp|A4VFI3|HEM6_PSEU5 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Pseudomonas stutzeri (strain A1501) GN=hemF PE=3 SV=1 | 54 | 357 | 2.0E-82 |
sp|A1JL37|HEM6_YERE8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-82 |
sp|C3LPC8|HEM6_VIBCM | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hemF PE=3 SV=1 | 54 | 356 | 3.0E-82 |
sp|Q5P7I0|HEM6_AROAE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Aromatoleum aromaticum (strain EbN1) GN=hemF PE=3 SV=1 | 54 | 356 | 4.0E-82 |
sp|A7N128|HEM6_VIBCB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hemF PE=3 SV=1 | 54 | 356 | 6.0E-82 |
sp|Q87FB2|HEM6_XYLFT | Oxygen-dependent coproporphyrinogen-III oxidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hemF PE=3 SV=1 | 53 | 357 | 9.0E-82 |
sp|A4ST50|HEM6_AERS4 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Aeromonas salmonicida (strain A449) GN=hemF PE=3 SV=1 | 47 | 357 | 2.0E-81 |
sp|Q8DDD5|HEM6_VIBVU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio vulnificus (strain CMCP6) GN=hemF PE=3 SV=1 | 57 | 356 | 5.0E-80 |
sp|B2U8Z4|HEM6_RALPJ | Oxygen-dependent coproporphyrinogen-III oxidase OS=Ralstonia pickettii (strain 12J) GN=hemF PE=3 SV=1 | 54 | 357 | 1.0E-79 |
sp|B7VMW3|HEM6_VIBTL | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio tasmaniensis (strain LGP32) GN=hemF PE=3 SV=1 | 54 | 356 | 2.0E-79 |
sp|Q7MGL4|HEM6_VIBVY | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio vulnificus (strain YJ016) GN=hemF PE=3 SV=1 | 57 | 356 | 2.0E-79 |
sp|B2VI13|HEM6_ERWT9 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemF PE=3 SV=1 | 47 | 357 | 3.0E-79 |
sp|P84155|HEM6_LEIMA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Leishmania major GN=LMAJ006828 PE=1 SV=1 | 54 | 357 | 4.0E-78 |
sp|Q87KE3|HEM6_VIBPA | Oxygen-dependent coproporphyrinogen-III oxidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hemF PE=3 SV=1 | 54 | 356 | 8.0E-78 |
sp|A0KEX7|HEM6_AERHH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=hemF PE=3 SV=1 | 47 | 357 | 1.0E-74 |
sp|Q8D1X2|HEM6_WIGBR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Wigglesworthia glossinidia brevipalpis GN=hemF PE=3 SV=1 | 57 | 357 | 2.0E-72 |
sp|C4K2Y8|HEM6_RICPU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia peacockii (strain Rustic) GN=hemF PE=3 SV=1 | 64 | 326 | 1.0E-70 |
sp|C3PM25|HEM6_RICAE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia africae (strain ESF-5) GN=hemF PE=3 SV=1 | 64 | 326 | 1.0E-70 |
sp|A8GU63|HEM6_RICRS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia rickettsii (strain Sheila Smith) GN=hemF PE=3 SV=1 | 64 | 326 | 4.0E-70 |
sp|B0BVQ3|HEM6_RICRO | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia rickettsii (strain Iowa) GN=hemF PE=3 SV=1 | 64 | 326 | 4.0E-70 |
sp|Q92FV8|HEM6_RICCN | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemF PE=3 SV=1 | 64 | 326 | 6.0E-70 |
sp|Q4UJP2|HEM6_RICFE | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemF PE=3 SV=1 | 64 | 326 | 1.0E-68 |
sp|Q68VN1|HEM6_RICTY | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemF PE=3 SV=1 | 64 | 326 | 4.0E-67 |
sp|Q9ZC86|HEM6_RICPR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia prowazekii (strain Madrid E) GN=hemF PE=3 SV=1 | 64 | 326 | 1.0E-66 |
sp|A8GQB7|HEM6_RICAH | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia akari (strain Hartford) GN=hemF PE=3 SV=1 | 64 | 326 | 2.0E-65 |
sp|A8GY81|HEM6_RICB8 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia bellii (strain OSU 85-389) GN=hemF PE=3 SV=1 | 64 | 331 | 2.0E-65 |
sp|Q1RGQ3|HEM6_RICBR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rickettsia bellii (strain RML369-C) GN=hemF PE=3 SV=1 | 64 | 331 | 3.0E-65 |
sp|Q54IA7|HEM6_DICDI | Oxygen-dependent coproporphyrinogen-III oxidase OS=Dictyostelium discoideum GN=cpox PE=3 SV=1 | 56 | 357 | 1.0E-60 |
sp|B0T8D1|HEM6_CAUSK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Caulobacter sp. (strain K31) GN=hemF PE=3 SV=1 | 77 | 331 | 4.0E-60 |
sp|Q8UD80|HEM6_AGRFC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hemF PE=3 SV=1 | 77 | 331 | 2.0E-58 |
sp|A6U9R1|HEM6_SINMW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Sinorhizobium medicae (strain WSM419) GN=hemF PE=3 SV=1 | 77 | 331 | 1.0E-57 |
sp|B9J7B2|HEM6_AGRRK | Oxygen-dependent coproporphyrinogen-III oxidase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=hemF PE=3 SV=1 | 34 | 331 | 5.0E-56 |
sp|Q9AAT8|HEM6_CAUCR | Oxygen-dependent coproporphyrinogen-III oxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hemF PE=3 SV=1 | 100 | 331 | 7.0E-56 |
sp|B8GZX1|HEM6_CAUCN | Oxygen-dependent coproporphyrinogen-III oxidase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hemF PE=3 SV=1 | 100 | 331 | 7.0E-56 |
sp|Q11GB4|HEM6_CHESB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Chelativorans sp. (strain BNC1) GN=hemF PE=3 SV=1 | 77 | 331 | 9.0E-56 |
sp|Q1MDJ5|HEM6_RHIL3 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=hemF PE=3 SV=1 | 77 | 331 | 2.0E-55 |
sp|B5ZY73|HEM6_RHILW | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=hemF PE=3 SV=1 | 77 | 331 | 1.0E-53 |
sp|B3PV29|HEM6_RHIE6 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rhizobium etli (strain CIAT 652) GN=hemF PE=3 SV=1 | 77 | 331 | 2.0E-53 |
sp|Q92PD8|HEM6_RHIME | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rhizobium meliloti (strain 1021) GN=hemF PE=3 SV=1 | 95 | 331 | 6.0E-53 |
sp|Q89SC2|HEM6_BRADU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hemF PE=3 SV=1 | 73 | 331 | 2.0E-51 |
sp|P63851|HEM6_BRUSU | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella suis biovar 1 (strain 1330) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|P63850|HEM6_BRUME | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|C0REI6|HEM6_BRUMB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|A9M6L4|HEM6_BRUC2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|Q57BW7|HEM6_BRUAB | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella abortus biovar 1 (strain 9-941) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|Q2YS10|HEM6_BRUA2 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella abortus (strain 2308) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|B2S710|HEM6_BRUA1 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Brucella abortus (strain S19) GN=hemF PE=3 SV=1 | 27 | 331 | 3.0E-50 |
sp|A6WZC8|HEM6_OCHA4 | Oxygen-dependent coproporphyrinogen-III oxidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hemF PE=3 SV=1 | 77 | 331 | 2.0E-49 |
sp|Q2K5S3|HEM6_RHIEC | Oxygen-dependent coproporphyrinogen-III oxidase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=hemF PE=3 SV=1 | 95 | 331 | 1.0E-48 |
sp|B9JZ61|HEM6_AGRVS | Oxygen-dependent coproporphyrinogen-III oxidase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=hemF PE=3 SV=1 | 95 | 331 | 2.0E-47 |
sp|Q93Z96|HEM62_ARATH | Coproporphyrinogen-III oxidase 2, chloroplastic OS=Arabidopsis thaliana GN=CPX2 PE=2 SV=1 | 50 | 199 | 1.0E-45 |
GO Term | Description | Terminal node |
---|---|---|
GO:0006779 | porphyrin-containing compound biosynthetic process | Yes |
GO:0004109 | coproporphyrinogen oxidase activity | Yes |
GO:0046483 | heterocycle metabolic process | No |
GO:0033014 | tetrapyrrole biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0009058 | biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0003824 | catalytic activity | No |
GO:0071704 | organic substance metabolic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0009987 | cellular process | No |
GO:0016634 | oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor | No |
GO:0008152 | metabolic process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0016491 | oxidoreductase activity | No |
GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0033013 | tetrapyrrole metabolic process | No |
GO:0006778 | porphyrin-containing compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044237 | cellular metabolic process | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Extracellular|Plastid | Signal peptide | 0.215 | 0.041 | 0.7545 | 0.1584 | 0.4866 | 0.7384 | 0.2474 | 0.2602 | 0.2845 | 0.1548 |
Orthofinder run ID | 4 |
Orthogroup | 3179 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|5697 MCFSAAAAILASPLALRLTAAEAFHLDATSLADKDAQKKRESGVGDNSPMRLRMEKFIKEQQLLIVRELEKVDGN EFRKDEWTRKNGGGGTTCVLQDGNVFEKAGVGVSVVYGSLPKPAIQKMRTDHKTLDPNVESLDFFAAGLSMVLHP RNPMAPTVHLNYRYFETANPDGSSQAWWFGGGSDLTPSYLFDEDAIHFHRTLKDTCDAHDKTYFPRFKKWCDEYF YNKHRGECRGIGGIFFDDLDESERDRDNTFAFIQDCLKSFLPSYLPILDKRKDMPFTDKEKEWQQIRRGKYVEFN LVHDRGTAFGLNTPGSRVESILMSLPLTACWKYMHEPESKSREQRLVDVLRDPKDWV* |
Coding | >Hirsu2|5697 ATGTGCTTTTCTGCCGCCGCAGCAATCCTGGCGTCTCCGCTGGCCTTACGACTGACTGCCGCCGAGGCTTTTCAT CTCGATGCCACGTCTCTGGCCGACAAGGATGCCCAAAAAAAACGCGAAAGCGGTGTGGGAGACAACTCCCCGATG AGACTGCGTATGGAGAAATTCATCAAGGAGCAGCAACTGCTTATTGTCCGAGAGCTTGAGAAGGTGGACGGCAAT GAGTTCCGCAAGGACGAGTGGACGCGCAAGAACGGTGGCGGCGGCACGACGTGTGTCTTACAAGATGGCAACGTC TTCGAGAAGGCGGGCGTGGGCGTGAGCGTTGTCTACGGCTCGCTGCCTAAGCCTGCCATTCAAAAGATGCGGACC GACCACAAGACTCTGGACCCCAATGTCGAGTCGCTCGACTTCTTCGCCGCCGGGCTTAGCATGGTGCTTCACCCG CGGAACCCCATGGCTCCCACCGTCCACCTCAACTACCGGTACTTCGAAACGGCTAATCCTGACGGGTCCTCCCAA GCGTGGTGGTTTGGCGGCGGTAGTGATCTGACGCCATCATATCTCTTCGACGAGGATGCTATACACTTCCACAGG ACACTCAAAGACACGTGTGACGCGCATGATAAGACGTACTTTCCTCGCTTCAAAAAGTGGTGTGACGAGTACTTT TACAACAAACATAGGGGCGAATGTCGAGGCATTGGCGGCATTTTTTTTGACGATCTGGACGAGTCTGAGCGCGAC CGTGATAACACATTTGCCTTCATACAGGACTGTCTCAAGTCTTTCCTCCCCTCTTATCTCCCCATCCTCGACAAG CGGAAGGATATGCCATTTACAGACAAGGAAAAGGAATGGCAGCAGATTCGTCGTGGAAAGTACGTTGAGTTCAAT TTGGTTCACGACCGCGGCACGGCTTTCGGTCTCAACACACCGGGATCACGCGTGGAGAGCATCCTCATGAGCCTA CCTCTAACAGCATGCTGGAAATACATGCACGAGCCCGAATCAAAGAGCAGGGAGCAGCGGCTCGTGGATGTGCTT AGAGATCCCAAGGACTGGGTTTGA |
Transcript | >Hirsu2|5697 ATGTGCTTTTCTGCCGCCGCAGCAATCCTGGCGTCTCCGCTGGCCTTACGACTGACTGCCGCCGAGGCTTTTCAT CTCGATGCCACGTCTCTGGCCGACAAGGATGCCCAAAAAAAACGCGAAAGCGGTGTGGGAGACAACTCCCCGATG AGACTGCGTATGGAGAAATTCATCAAGGAGCAGCAACTGCTTATTGTCCGAGAGCTTGAGAAGGTGGACGGCAAT GAGTTCCGCAAGGACGAGTGGACGCGCAAGAACGGTGGCGGCGGCACGACGTGTGTCTTACAAGATGGCAACGTC TTCGAGAAGGCGGGCGTGGGCGTGAGCGTTGTCTACGGCTCGCTGCCTAAGCCTGCCATTCAAAAGATGCGGACC GACCACAAGACTCTGGACCCCAATGTCGAGTCGCTCGACTTCTTCGCCGCCGGGCTTAGCATGGTGCTTCACCCG CGGAACCCCATGGCTCCCACCGTCCACCTCAACTACCGGTACTTCGAAACGGCTAATCCTGACGGGTCCTCCCAA GCGTGGTGGTTTGGCGGCGGTAGTGATCTGACGCCATCATATCTCTTCGACGAGGATGCTATACACTTCCACAGG ACACTCAAAGACACGTGTGACGCGCATGATAAGACGTACTTTCCTCGCTTCAAAAAGTGGTGTGACGAGTACTTT TACAACAAACATAGGGGCGAATGTCGAGGCATTGGCGGCATTTTTTTTGACGATCTGGACGAGTCTGAGCGCGAC CGTGATAACACATTTGCCTTCATACAGGACTGTCTCAAGTCTTTCCTCCCCTCTTATCTCCCCATCCTCGACAAG CGGAAGGATATGCCATTTACAGACAAGGAAAAGGAATGGCAGCAGATTCGTCGTGGAAAGTACGTTGAGTTCAAT TTGGTTCACGACCGCGGCACGGCTTTCGGTCTCAACACACCGGGATCACGCGTGGAGAGCATCCTCATGAGCCTA CCTCTAACAGCATGCTGGAAATACATGCACGAGCCCGAATCAAAGAGCAGGGAGCAGCGGCTCGTGGATGTGCTT AGAGATCCCAAGGACTGGGTTTGA |
Gene | >Hirsu2|5697 ATGTGCTTTTCTGCCGCCGCAGCAATCCTGGCGTCTCCGCTGGCCTTACGACTGGTACGACCTGAGATCCTCCTT CCACACTTATATGTAGGACGCCTCCGCTGACCTGGTTACTCGTGCACTCTCAGACTGCCGCCGAGGCTTTTCATC TCGATGCCACGTCTCTGGCCGACAAGGATGCCCAAAAAAAACGCGAAAGCGGTGTGGGAGACAACTCCCCGATGA GACTGCGTATGGAGAAATTCATCAAGGAGCAGCAACTGCTTATTGTCCGAGAGCTTGAGAAGGTGGACGGCAATG AGTTCCGCAAGGACGAGTGGACGCGCAAGAACGGTGGCGGCGGCACGACGTGTGTCTTACAAGATGGCAACGTCT TCGAGAAGGCGGGCGTGGGCGTGAGCGTTGTCTACGGCTCGCTGCCTAAGCCTGCCATTCAAAAGATGCGGACCG ACCACAAGACTCTGGACCCCAATGTCGAGTCGCTCGACTTCTTCGCCGCCGGGCTTAGCATGGTGCTTCACCCGC GGAACCCCATGGCTCCCACCGTCCACCTCAACTACCGGTACTTCGAAACGGCTAATCCTGACGGGTCCTCCCAAG CGTGGTGGTTTGGCGGCGGTAGTGATCTGACGCCATCATATCTCTTCGACGAGGATGCTATACACTTCCACAGGA CACTCAAAGACACGTGTGACGCGCATGATAAGACGTACTTTCCTCGCTTCAAAAAGTGGTGTGACGAGTACTTTT ACAACAAACATAGGGGCGAATGTCGAGGCATTGGCGGCATTTTTTTTGACGATCTGGACGAGTCTGAGCGCGACC GTGATAACACATTTGCCTTCATACAGGACTGTCTCAAGTCTTTCCTCCCCTCTTATCTCCCCATCCTCGACAAGC GGAAGGATATGCCATTTACAGACAAGGAAAAGGAATGGCAGCAGATTCGTCGTGGAAAGTACGTTGAGTTCAATT TGGTTCACGACCGCGGCACGGCTTTCGGTCTCAACACACCGGGATCACGCGTGGAGAGCATCCTCATGAGCCTAC CTCTAACAGCATGCTGGAAATACATGCACGAGCCCGAATCAAAGAGCAGGGAGCAGCGGCTCGTGGATGTGCTTA GAGATCCCAAGGACTGGGTTTGA |