Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5692
Gene name
LocationContig_2862:645..1722
Strand+
Gene length (bp)1077
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00364 Biotin_lipoyl Biotin-requiring enzyme 7.6E-18 58 128
PF02817 E3_binding e3 binding domain 5.1E-13 183 216
PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 3.7E-08 237 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 41 281 3.0E-45
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 59 278 1.0E-41
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 59 281 3.0E-41
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 59 288 3.0E-41
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 59 284 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 41 281 3.0E-45
sp|Q9M7Z1|ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=BCE2 PE=1 SV=1 59 278 1.0E-41
sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 59 281 3.0E-41
sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=1 SV=2 59 288 3.0E-41
sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 59 284 2.0E-39
sp|P21883|ODP2_BACSU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=pdhC PE=1 SV=2 59 291 4.0E-26
sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 59 291 2.0E-25
sp|P65635|ODP2_STAAM Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhC PE=3 SV=1 59 291 2.0E-25
sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 59 291 3.0E-25
sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 59 291 3.0E-25
sp|Q5HGY9|ODP2_STAAC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=pdhC PE=3 SV=1 59 291 3.0E-25
sp|Q6GHZ0|ODP2_STAAR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=pdhC PE=3 SV=1 59 291 5.0E-25
sp|Q59821|ODP2_STAAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus GN=pdhC PE=3 SV=1 59 291 5.0E-25
sp|Q8CT13|ODP2_STAES Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1 59 291 1.0E-23
sp|P37942|ODB2_BACSU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=bfmBB PE=3 SV=1 53 281 3.0E-23
sp|Q5HQ74|ODP2_STAEQ Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1 59 291 4.0E-23
sp|Q9I1M0|ODB2_PSEAE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bkdB PE=1 SV=1 57 291 8.0E-23
sp|P09062|ODB2_PSEPU Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas putida GN=bkdB PE=3 SV=1 57 282 4.0E-20
sp|P11961|ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus GN=pdhC PE=1 SV=3 59 289 9.0E-20
sp|P06959|ODP2_ECOLI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3 54 295 1.0E-14
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 59 278 4.0E-14
sp|Q1RHI5|ODO2_RICBR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=sucB PE=3 SV=1 57 280 1.0E-13
sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 66 295 3.0E-13
sp|Q5M729|ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=2 SV=1 41 282 5.0E-12
sp|Q6ABX9|ODP2_LEIXX Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdhC PE=3 SV=1 58 281 4.0E-11
sp|Q92J43|ODO2_RICCN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucB PE=3 SV=1 57 280 6.0E-11
sp|Q4UKI7|ODO2_RICFE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucB PE=3 SV=1 57 280 7.0E-11
sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 15 286 2.0E-10
sp|P45118|ODP2_HAEIN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aceF PE=3 SV=1 52 295 7.0E-10
sp|Q49110|ODP2_MYCCT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pdhC PE=3 SV=1 57 296 1.0E-09
sp|P16263|ODO2_BACSU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) GN=odhB PE=3 SV=2 61 219 1.0E-09
sp|O06159|BKDC_MYCTU Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bkdC PE=1 SV=2 61 216 2.0E-09
sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 79 282 3.0E-09
sp|Q5HPC7|ODO2_STAEQ Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=odhB PE=3 SV=1 57 280 6.0E-09
sp|Q8CSL9|ODO2_STAES Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=odhB PE=3 SV=1 57 280 1.0E-08
sp|Q8RWN9|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=2 SV=2 41 282 2.0E-08
sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 57 285 1.0E-07
sp|Q68XI8|ODO2_RICTY Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucB PE=3 SV=1 57 222 1.0E-07
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 61 132 3.0E-07
sp|Q59638|ODP2_PSEAE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aceF PE=2 SV=2 53 221 3.0E-07
sp|Q6FYD4|ODO2_BARQU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bartonella quintana (strain Toulouse) GN=sucB PE=3 SV=1 62 280 3.0E-07
sp|Q8NWR7|ODO2_STAAW Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=odhB PE=3 SV=1 57 280 4.0E-07
sp|Q6G9E9|ODO2_STAAS Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=odhB PE=3 SV=1 57 280 4.0E-07
sp|Q5HG07|ODO2_STAAC Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=odhB PE=3 SV=1 57 280 4.0E-07
sp|Q2FYM2|ODO2_STAA8 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain NCTC 8325) GN=odhB PE=3 SV=1 57 280 4.0E-07
sp|Q2FH26|ODO2_STAA3 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain USA300) GN=odhB PE=3 SV=1 57 280 4.0E-07
sp|Q9ZD20|ODP2_RICPR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=pdhC PE=3 SV=1 68 290 4.0E-07
sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 57 283 6.0E-07
sp|Q9ZDY4|ODO2_RICPR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia prowazekii (strain Madrid E) GN=sucB PE=3 SV=1 57 222 6.0E-07
sp|Q7A5N4|ODO2_STAAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=odhB PE=1 SV=1 57 280 6.0E-07
sp|Q99U75|ODO2_STAAM Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=odhB PE=3 SV=1 57 280 6.0E-07
sp|P35489|ODP2_ACHLA Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1 59 129 7.0E-07
sp|O31550|ACOC_BACSU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Bacillus subtilis (strain 168) GN=acoC PE=3 SV=1 52 282 7.0E-07
sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 46 285 2.0E-06
sp|Q2YY06|ODO2_STAAB Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=odhB PE=3 SV=1 57 280 2.0E-06
sp|P10802|ODP2_AZOVI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Azotobacter vinelandii PE=1 SV=3 71 278 2.0E-06
sp|P9WIS7|ODP2_MYCTU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dlaT PE=1 SV=1 55 122 2.0E-06
sp|P9WIS6|ODP2_MYCTO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dlaT PE=3 SV=1 55 122 2.0E-06
sp|P65634|ODP2_MYCBO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dlaT PE=3 SV=1 55 122 2.0E-06
sp|Q6GGZ6|ODO2_STAAR Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus aureus (strain MRSA252) GN=odhB PE=3 SV=1 57 280 3.0E-06
sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 46 285 4.0E-06
sp|Q4ULG1|ODP2_RICFE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pdhC PE=3 SV=1 57 290 5.0E-06
sp|Q49XM4|ODO2_STAS1 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=odhB PE=3 SV=1 57 280 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 transferase activity, transferring acyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5692
MFLLRRSRLLLRRQVQAPRALGRVAVARAGGGGGVVRGAAAARRFSQSARLCAVKPVLLADIGEGIVECEVIQWF
VEPGARVEEFSPLCEVQSDKASVEITSRFAGTVKKLYYEAGEMARVGKPFVDIDIEGPAPAAEAEEPARQDEAKT
VPMPTEQTAGQALSPMPGPAEGTAKAKGKMAGLATPAVRHLSKELKVDIGDVDGTGRDGRVLKEDIHKFVQAREA
GQTAGPPAAGQGEYRVPLGATQQHMFKTMTRSLAIPHFLYADEIDFTGLTELRARLNRVLAAQRCRWRCTASRC*
Coding >Hirsu2|5692
ATGTTCCTCCTGCGTCGCTCCAGGCTCCTCCTGCGCAGGCAGGTGCAGGCCCCGAGGGCATTGGGCCGCGTCGCC
GTGGCGAGGGCCGGCGGCGGCGGCGGCGTCGTGAGGGGCGCGGCGGCGGCCCGACGGTTCAGCCAGTCGGCAAGG
CTCTGCGCCGTCAAGCCCGTCCTGCTGGCCGACATTGGAGAGGGAATCGTCGAGTGCGAGGTGATACAATGGTTC
GTCGAGCCGGGCGCGCGCGTCGAGGAGTTCTCGCCGCTGTGCGAGGTGCAGAGCGACAAGGCGTCGGTGGAGATC
ACGAGCCGCTTCGCCGGCACCGTCAAGAAGCTGTACTACGAGGCGGGCGAGATGGCCCGGGTGGGCAAGCCGTTT
GTCGACATCGACATTGAGGGCCCGGCGCCGGCGGCGGAGGCGGAGGAGCCGGCCCGGCAGGACGAGGCCAAGACG
GTGCCGATGCCGACGGAGCAGACGGCGGGCCAGGCCCTGTCGCCGATGCCGGGCCCGGCCGAGGGCACGGCCAAG
GCCAAGGGCAAGATGGCCGGGCTGGCGACGCCGGCGGTGCGGCACCTGTCCAAGGAGCTCAAGGTCGACATCGGC
GACGTCGACGGCACCGGCAGGGACGGGAGGGTGCTCAAGGAGGACATCCACAAGTTCGTGCAGGCACGGGAGGCG
GGCCAGACGGCGGGCCCCCCGGCGGCGGGCCAGGGCGAGTATCGGGTCCCGCTGGGCGCGACGCAGCAGCACATG
TTCAAGACGATGACGCGGTCGCTGGCGATCCCGCACTTCCTCTACGCCGACGAGATCGACTTCACCGGCCTGACG
GAGCTGCGGGCGCGGCTCAACCGCGTGCTGGCGGCGCAGCGGTGTCGCTGGCGCTGTACCGCTTCCCGCTGCTGA
Transcript >Hirsu2|5692
ATGTTCCTCCTGCGTCGCTCCAGGCTCCTCCTGCGCAGGCAGGTGCAGGCCCCGAGGGCATTGGGCCGCGTCGCC
GTGGCGAGGGCCGGCGGCGGCGGCGGCGTCGTGAGGGGCGCGGCGGCGGCCCGACGGTTCAGCCAGTCGGCAAGG
CTCTGCGCCGTCAAGCCCGTCCTGCTGGCCGACATTGGAGAGGGAATCGTCGAGTGCGAGGTGATACAATGGTTC
GTCGAGCCGGGCGCGCGCGTCGAGGAGTTCTCGCCGCTGTGCGAGGTGCAGAGCGACAAGGCGTCGGTGGAGATC
ACGAGCCGCTTCGCCGGCACCGTCAAGAAGCTGTACTACGAGGCGGGCGAGATGGCCCGGGTGGGCAAGCCGTTT
GTCGACATCGACATTGAGGGCCCGGCGCCGGCGGCGGAGGCGGAGGAGCCGGCCCGGCAGGACGAGGCCAAGACG
GTGCCGATGCCGACGGAGCAGACGGCGGGCCAGGCCCTGTCGCCGATGCCGGGCCCGGCCGAGGGCACGGCCAAG
GCCAAGGGCAAGATGGCCGGGCTGGCGACGCCGGCGGTGCGGCACCTGTCCAAGGAGCTCAAGGTCGACATCGGC
GACGTCGACGGCACCGGCAGGGACGGGAGGGTGCTCAAGGAGGACATCCACAAGTTCGTGCAGGCACGGGAGGCG
GGCCAGACGGCGGGCCCCCCGGCGGCGGGCCAGGGCGAGTATCGGGTCCCGCTGGGCGCGACGCAGCAGCACATG
TTCAAGACGATGACGCGGTCGCTGGCGATCCCGCACTTCCTCTACGCCGACGAGATCGACTTCACCGGCCTGACG
GAGCTGCGGGCGCGGCTCAACCGCGTGCTGGCGGCGCAGCGGTGTCGCTGGCGCTGTACCGCTTCCCGCTGCTGA
Gene >Hirsu2|5692
ATGTTCCTCCTGCGTCGCTCCAGGCTCCTCCTGCGCAGGCAGGTGCAGGCCCCGAGGGCATTGGGCCGCGTCGCC
GTGGCGAGGGCCGGCGGCGGCGGCGGCGTCGTGAGGGGCGCGGCGGCGGCCCGACGGTTCAGCCAGTCGGCAAGG
CTCTGCGCCGTCAAGCCCGTCCTGCTGGCCGACATTGGAGAGGGTGAGTGGCGCGGGTGCGAGCCCCGGGCCGGT
CCGTCGTCTGACGCCGCAGGCAACCAGGAATCGTCGAGTGCGAGGTGATACAATGGTTCGTCGAGCCGGGCGCGC
GCGTCGAGGAGTTCTCGCCGCTGTGCGAGGTGCAGAGCGACAAGGCGTCGGTGGAGATCACGAGCCGCTTCGCCG
GCACCGTCAAGAAGCTGTACTACGAGGCGGGCGAGATGGCCCGGGTGGGCAAGCCGTTTGTCGACATCGACATTG
AGGGCCCGGCGCCGGCGGCGGAGGCGGAGGAGCCGGCCCGGCAGGACGAGGCCAAGACGGTGCCGATGCCGACGG
AGCAGACGGCGGGCCAGGCCCTGTCGCCGATGCCGGGCCCGGCCGAGGGCACGGCCAAGGCCAAGGGCAAGATGG
CCGGGCTGGCGACGCCGGCGGTGCGGCACCTGTCCAAGGAGCTCAAGGTCGACATCGGCGACGTCGACGGCACCG
GCAGGGACGGGAGGGTGCTCAAGGAGGACATCCACAAGTTCGTGCAGGCACGGGAGGCGGGCCAGACGGCGGGCC
CCCCGGCGGCGGGCCAGGGCGAGTATCGGGTCCCGCTGGGCGCGACGCAGCAGCACATGTTCAAGACGATGACGC
GGTCGCTGGCGATCCCGCACTTCCTCTACGCCGACGAGATCGACTTCACCGGCCTGACGGAGCTGCGGGCGCGGC
TCAACCGCGTGCTGGCGGCGCAGTCGGCGGGGCCGGGGCCGGAGGGACAGGGGCCGGAGCCGGCGGCGGCGCCTG
GGCCGGAAGCGGCGGCGGAAGCGGGAGCGGTGCAGAAGCTGTCGTACCTCCCCTTCATCATCAAGGCGGTGTCGC
TGGCGCTGTACCGCTTCCCGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail