Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|569
Gene name
LocationContig_1110:1871..3753
Strand+
Gene length (bp)1882
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11051 Mannosyl_trans3 Mannosyltransferase putative 7.3E-54 229 469

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YS7|MNN14_CANAL Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN14 PE=2 SV=1 228 467 2.0E-22
sp|Q5APQ8|MNN12_CANAL Putative alpha-1,3-mannosyltransferase MNN12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN12 PE=3 SV=1 228 461 2.0E-21
sp|Q5AGA0|MNN1_CANAL Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN1 PE=2 SV=1 228 460 8.0E-20
sp|Q5AGA9|MNN13_CANAL Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN13 PE=2 SV=1 228 472 5.0E-17
sp|P39106|MNN1_YEAST Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN1 PE=1 SV=1 171 527 9.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YS7|MNN14_CANAL Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN14 PE=2 SV=1 228 467 2.0E-22
sp|Q5APQ8|MNN12_CANAL Putative alpha-1,3-mannosyltransferase MNN12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN12 PE=3 SV=1 228 461 2.0E-21
sp|Q5AGA0|MNN1_CANAL Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN1 PE=2 SV=1 228 460 8.0E-20
sp|Q5AGA9|MNN13_CANAL Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN13 PE=2 SV=1 228 472 5.0E-17
sp|P39106|MNN1_YEAST Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN1 PE=1 SV=1 171 527 9.0E-17
sp|Q59VL7|MNN15_CANAL Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN15 PE=2 SV=1 215 546 1.0E-16
sp|P53059|MNT2_YEAST Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNT2 PE=1 SV=1 221 529 2.0E-14
sp|P53745|MNT4_YEAST Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNT4 PE=3 SV=1 221 529 3.0E-14
sp|Q5A687|MNN22_CANAL Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN22 PE=2 SV=1 223 350 3.0E-08
sp|Q5AD72|MNN24_CANAL Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN24 PE=3 SV=1 229 350 2.0E-07
sp|Q59KJ7|MNN21_CANAL Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN21 PE=3 SV=1 230 350 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|569
MGRLDEPWHEPQTAGRFARPPRRTLRILRRIAIPVILICVVCFQLSSYRAAGPSRRPWPAFPLGGPTDLDAEFAG
VVARPTTTPGDELPARRPSFIDVFTRVVDSFPDETEAERLLSQIKGTGTSKIREVGLRARKYKQYFEAWEELHLS
INEQDGNYVRDDVVQHLRRHFRGLDPASAEPIGGGLAQAVRSYEDRRQFLAKFGHFLFPWTAPYFPDHRVLHSHF
RQSGRGIVFTAGDAGAPFMLTSILALRRLGCSLPIEIMYLGDSDLGEHHRARFERLDGVLTRDISRMVNDEGWTL
SGWAAKPFAILLSSFREVIFIDADSLFFRDPEILFDDPGYVATGALFYRDRVMLAESKKAWLQKLLPEPISQQVK
QNRYWTGESGHMQESGVVVVDKWKHFVALLMVARLNGPDRNGDSNKGTVGMYDMVHGDKETFWLGWELVGDLDYV
FHEGDAGALGVFQESEEGGDEKGGRREAQGGKGTAAGDAAEAGEGVAEKGTTDRPWTMCAPQLLHLDLDRRPLWF
NGWLLENKFAETDKRRFSKFEHFLIEPRDGRQPEAWQLKENNLCCLTAETRFKGTFTLEEEKALNMMLELAREAN
ATIGL*
Coding >Hirsu2|569
ATGGGCCGGCTTGACGAACCGTGGCATGAGCCACAAACGGCCGGCCGCTTCGCCAGGCCGCCGAGACGTACCCTG
AGGATACTTCGCCGAATTGCGATCCCGGTGATACTGATATGCGTCGTCTGCTTCCAGCTGTCGTCTTACCGAGCC
GCCGGCCCCTCGAGGCGACCATGGCCGGCTTTCCCCCTTGGCGGACCGACCGACCTGGATGCCGAGTTCGCGGGA
GTCGTGGCCCGGCCCACAACCACGCCCGGCGACGAACTCCCGGCCCGGCGGCCCAGCTTCATCGACGTCTTCACC
CGCGTCGTCGACAGCTTCCCGGACGAGACCGAGGCCGAGCGGCTGCTCTCGCAGATCAAAGGCACCGGCACCAGC
AAGATCCGCGAGGTTGGCCTTCGGGCTCGCAAGTATAAGCAGTATTTCGAGGCGTGGGAGGAGTTGCATCTCTCC
ATCAACGAGCAGGACGGCAACTACGTCCGCGACGACGTGGTGCAGCATCTCCGCCGCCACTTTCGCGGCCTGGAC
CCGGCTTCGGCCGAGCCCATCGGTGGCGGTCTCGCCCAAGCGGTGCGCTCCTACGAGGACCGCCGTCAGTTCCTG
GCCAAGTTCGGCCACTTCCTCTTCCCGTGGACGGCCCCCTACTTCCCCGACCACAGGGTCCTCCACTCCCACTTC
AGACAGAGCGGCCGGGGCATCGTCTTCACGGCCGGTGACGCCGGCGCTCCCTTCATGCTCACGTCGATCCTCGCC
CTGCGGAGGCTCGGATGCTCGCTCCCCATCGAGATCATGTATTTGGGCGACTCGGACCTCGGCGAGCACCACCGC
GCCCGCTTCGAGCGGCTTGACGGGGTGCTGACCCGCGACATTTCCCGTATGGTCAACGACGAGGGCTGGACGCTC
TCCGGCTGGGCGGCTAAGCCCTTCGCCATCCTCCTCTCGAGCTTTCGCGAAGTCATCTTCATCGACGCCGACAGC
CTGTTCTTCCGCGATCCCGAGATCTTGTTCGACGACCCCGGATACGTCGCCACCGGCGCGCTCTTCTACCGAGAT
CGAGTCATGTTGGCCGAGTCCAAGAAGGCTTGGCTCCAGAAGCTCCTGCCCGAACCCATCTCGCAGCAGGTGAAG
CAGAACCGGTACTGGACCGGCGAGAGCGGCCACATGCAAGAATCGGGTGTCGTGGTGGTCGACAAGTGGAAGCAC
TTCGTCGCTCTCCTCATGGTGGCCCGGCTCAACGGTCCCGACAGGAACGGAGACTCGAACAAGGGCACGGTCGGC
ATGTACGACATGGTACACGGTGACAAGGAGACCTTCTGGCTCGGATGGGAGCTCGTCGGCGATCTGGACTACGTC
TTCCATGAGGGCGACGCGGGCGCCTTGGGCGTCTTTCAAGAATCCGAAGAAGGCGGCGACGAAAAAGGAGGCCGG
CGAGAGGCGCAGGGCGGCAAAGGCACGGCCGCCGGAGACGCCGCGGAAGCAGGTGAGGGCGTCGCCGAGAAGGGC
ACCACGGACCGGCCTTGGACAATGTGCGCTCCCCAATTGCTGCATCTGGACCTGGACAGACGACCGCTGTGGTTC
AACGGATGGCTGTTGGAAAACAAATTTGCGGAGACGGATAAGAGGAGGTTCAGCAAGTTCGAGCATTTCCTCATC
GAGCCGCGAGACGGCAGACAGCCGGAAGCCTGGCAGCTGAAGGAGAACAACCTCTGCTGTCTGACGGCCGAGACC
CGGTTCAAGGGCACGTTCACTCTCGAGGAGGAGAAAGCACTAAACATGATGTTGGAATTGGCGAGAGAGGCCAAC
GCCACCATCGGATTGTGA
Transcript >Hirsu2|569
ATGGGCCGGCTTGACGAACCGTGGCATGAGCCACAAACGGCCGGCCGCTTCGCCAGGCCGCCGAGACGTACCCTG
AGGATACTTCGCCGAATTGCGATCCCGGTGATACTGATATGCGTCGTCTGCTTCCAGCTGTCGTCTTACCGAGCC
GCCGGCCCCTCGAGGCGACCATGGCCGGCTTTCCCCCTTGGCGGACCGACCGACCTGGATGCCGAGTTCGCGGGA
GTCGTGGCCCGGCCCACAACCACGCCCGGCGACGAACTCCCGGCCCGGCGGCCCAGCTTCATCGACGTCTTCACC
CGCGTCGTCGACAGCTTCCCGGACGAGACCGAGGCCGAGCGGCTGCTCTCGCAGATCAAAGGCACCGGCACCAGC
AAGATCCGCGAGGTTGGCCTTCGGGCTCGCAAGTATAAGCAGTATTTCGAGGCGTGGGAGGAGTTGCATCTCTCC
ATCAACGAGCAGGACGGCAACTACGTCCGCGACGACGTGGTGCAGCATCTCCGCCGCCACTTTCGCGGCCTGGAC
CCGGCTTCGGCCGAGCCCATCGGTGGCGGTCTCGCCCAAGCGGTGCGCTCCTACGAGGACCGCCGTCAGTTCCTG
GCCAAGTTCGGCCACTTCCTCTTCCCGTGGACGGCCCCCTACTTCCCCGACCACAGGGTCCTCCACTCCCACTTC
AGACAGAGCGGCCGGGGCATCGTCTTCACGGCCGGTGACGCCGGCGCTCCCTTCATGCTCACGTCGATCCTCGCC
CTGCGGAGGCTCGGATGCTCGCTCCCCATCGAGATCATGTATTTGGGCGACTCGGACCTCGGCGAGCACCACCGC
GCCCGCTTCGAGCGGCTTGACGGGGTGCTGACCCGCGACATTTCCCGTATGGTCAACGACGAGGGCTGGACGCTC
TCCGGCTGGGCGGCTAAGCCCTTCGCCATCCTCCTCTCGAGCTTTCGCGAAGTCATCTTCATCGACGCCGACAGC
CTGTTCTTCCGCGATCCCGAGATCTTGTTCGACGACCCCGGATACGTCGCCACCGGCGCGCTCTTCTACCGAGAT
CGAGTCATGTTGGCCGAGTCCAAGAAGGCTTGGCTCCAGAAGCTCCTGCCCGAACCCATCTCGCAGCAGGTGAAG
CAGAACCGGTACTGGACCGGCGAGAGCGGCCACATGCAAGAATCGGGTGTCGTGGTGGTCGACAAGTGGAAGCAC
TTCGTCGCTCTCCTCATGGTGGCCCGGCTCAACGGTCCCGACAGGAACGGAGACTCGAACAAGGGCACGGTCGGC
ATGTACGACATGGTACACGGTGACAAGGAGACCTTCTGGCTCGGATGGGAGCTCGTCGGCGATCTGGACTACGTC
TTCCATGAGGGCGACGCGGGCGCCTTGGGCGTCTTTCAAGAATCCGAAGAAGGCGGCGACGAAAAAGGAGGCCGG
CGAGAGGCGCAGGGCGGCAAAGGCACGGCCGCCGGAGACGCCGCGGAAGCAGGTGAGGGCGTCGCCGAGAAGGGC
ACCACGGACCGGCCTTGGACAATGTGCGCTCCCCAATTGCTGCATCTGGACCTGGACAGACGACCGCTGTGGTTC
AACGGATGGCTGTTGGAAAACAAATTTGCGGAGACGGATAAGAGGAGGTTCAGCAAGTTCGAGCATTTCCTCATC
GAGCCGCGAGACGGCAGACAGCCGGAAGCCTGGCAGCTGAAGGAGAACAACCTCTGCTGTCTGACGGCCGAGACC
CGGTTCAAGGGCACGTTCACTCTCGAGGAGGAGAAAGCACTAAACATGATGTTGGAATTGGCGAGAGAGGCCAAC
GCCACCATCGGATTGTGA
Gene >Hirsu2|569
ATGGGCCGGCTTGACGAACCGTGGCATGAGCCACAAACGGCCGGCCGCTTCGCCAGGCCGCCGAGACGTACCCTG
AGGATACTTCGCCGAATTGCGATCCCGGTGATACTGATATGCGTCGTCTGCTTCCAGCTGTCGTCTTACCGAGCC
GCCGGCCCCTCGAGGCGACCATGGCCGGCTTTCCCCCTTGGCGGACCGACCGACCTGGATGCCGAGTTCGCGGGA
GTCGTGGCCCGGCCCACAACCACGCCCGGCGACGAACTCCCGGCCCGGCGGCCCAGCTTCATCGACGTCTTCACC
CGCGTCGTCGACAGCTTCCCGGACGAGACCGAGGCCGAGCGGCTGCTCTCGCAGATCAAAGGCACCGGCACCAGC
AAGATCCGCGAGGTTGGCCTTCGGGCTCGCAAGTATAAGCAGTATTTCGAGGCGTGGGAGGAGTTGCATCTCTCC
ATCAACGAGCAGGACGGCAACTACGTCCGCGACGACGTGGTGCAGCATCTCCGCCGCCACTTTCGCGGCCTGGAC
CCGGCTTCGGCCGAGCCCATCGGTGGCGGTCTCGCCCAAGCGGTGCGCTCCTACGAGGACCGCCGTCAGTTCCTG
GCCAAGTTCGGCCACTTCCTCTTCCCGTGGACGGCCCCCTACTTCCCCGACCACAGGGTCCTCCACTCCCACTTC
AGACAGAGCGGCCGGGGCATCGTCTTCACGGCCGGTGACGCCGGCGCTCCCTTCATGCTCACGTCGATCCTCGCC
CTGCGGAGGCTCGGATGCTCGCTCCCCATCGAGATCATGTATTTGGGCGACTCGGACCTCGGCGAGCACCACCGC
GCCCGCTTCGAGCGGCTTGACGGGGTGCTGACCCGCGACATTTCCCGTATGGTCAACGACGAGGGCTGGACGCTC
TCCGGCTGGGCGGCTAAGCCCTTCGCCATCCTCCTCTCGAGCTTTCGCGAAGTCATCTTCATCGACGCCGACAGC
CTGTTCTTCCGCGATCCCGAGATCTTGTTCGACGACCCCGGATACGTCGCCACCGGCGCGCTCTTCTACCGAGAT
CGAGTCATGTTGGCCGAGTCCAAGAAGGCTTGGCTCCAGAAGCTCCTGCCCGAACCCATCTCGCAGCAGGTGAAG
CAGAACCGGTACTGGACCGGCGAGAGCGGCCACATGCAAGAATCGGGTGTCGTGGTGGTCGACAAGTGGAAGCAC
TTCGTCGCTCTCCTCATGGTGGCCCGGCTCAACGGTCCCGACAGGAACGGAGACTCGAACAAGGGCACGGTCGGC
ATGTACGACATGGTACACGGTATGCCCAGTGCCCCATGGATTTGCGGCAGGGCGCCCGGCTAACGTGTGACGTCT
TCTCCCAGGTGACAAGGAGACCTTCTGGCTCGGATGGGAGCTCGTCGGCGATCTGGACTACGTCTTCCATGAGGG
CGACGCGGGCGCCTTGGGCGTCTTTCAAGAATCCGAAGAAGGCGGCGACGAAAAAGGAGGCCGGCGAGAGGCGCA
GGGCGGCAAAGGCACGGCCGCCGGAGACGCCGCGGAAGCAGGTGAGGGCGTCGCCGAGAAGGGCACCACGGACCG
GCCTTGGACAATGTGCGCTCCCCAATTGCTGCATCTGGACCTGGACAGACGACCGCTGTGGTTCAACGGATGGCT
GTTGGAAAACAAATTTGCGGAGACGGATAAGAGGAGGTTCAGCAAGTTCGAGCATTTCCTCATCGAGCCGCGAGA
CGGCAGACAGCCGGAAGCCTGGCAGCTGAAGGAGAACAACCTCTGCTGTCTGACGGCCGAGACCCGGTTCAAGGG
CACGTTCACTCTCGAGGAGGAGAAAGCACTAAACATGATGTTGGAATTGGCGAGAGAGGCCAACGCCACCATCGG
ATTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail