Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5684
Gene name
LocationContig_286:6844..8371
Strand+
Gene length (bp)1527
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.2E-36 49 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 49 376 2.0E-22
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 49 376 3.0E-22
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 3 376 2.0E-19
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 49 376 1.0E-18
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 48 360 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 49 376 2.0E-22
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 49 376 3.0E-22
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 3 376 2.0E-19
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 49 376 1.0E-18
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 48 360 1.0E-18
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 56 376 4.0E-18
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 42 396 4.0E-18
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 35 364 5.0E-17
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 35 364 2.0E-16
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 35 364 4.0E-16
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 33 370 3.0E-15
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 35 376 3.0E-15
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 3 391 2.0E-14
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 27 364 6.0E-14
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 43 375 6.0E-14
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 27 364 8.0E-14
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 73 375 4.0E-13
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 35 376 6.0E-13
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 50 376 6.0E-13
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 33 370 1.0E-12
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 34 370 1.0E-12
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 33 375 1.0E-12
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 34 370 1.0E-12
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 35 376 1.0E-12
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 49 364 2.0E-12
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 49 364 3.0E-12
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 34 370 3.0E-12
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 49 364 3.0E-12
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 35 376 3.0E-12
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 39 373 4.0E-12
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 33 375 6.0E-12
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 39 372 6.0E-12
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 42 364 1.0E-11
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 33 375 2.0E-11
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 179 364 3.0E-11
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 50 265 3.0E-11
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 50 265 3.0E-11
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 35 376 4.0E-11
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 39 373 4.0E-11
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 35 364 5.0E-11
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 50 265 7.0E-11
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 50 265 8.0E-11
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 47 364 8.0E-11
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 43 370 8.0E-11
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 34 370 9.0E-11
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 39 244 1.0E-10
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 49 384 1.0E-10
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 37 373 1.0E-10
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 50 265 1.0E-10
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 50 265 1.0E-10
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 39 244 2.0E-10
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 39 270 2.0E-10
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 34 370 2.0E-10
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 37 372 2.0E-10
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 51 364 2.0E-10
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 27 375 2.0E-10
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 47 364 4.0E-10
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 23 372 7.0E-10
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 39 373 8.0E-10
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 47 364 1.0E-09
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 47 364 1.0E-09
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 50 265 1.0E-09
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 21 265 2.0E-09
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 49 384 2.0E-09
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 47 364 3.0E-09
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 49 370 3.0E-09
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 25 364 4.0E-09
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 50 375 4.0E-09
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 49 375 6.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 30 372 7.0E-09
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 50 372 1.0E-08
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 49 227 2.0E-08
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 39 227 2.0E-08
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 33 372 3.0E-08
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 30 372 3.0E-08
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 37 270 4.0E-08
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 49 301 5.0E-08
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 49 376 5.0E-08
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 206 364 1.0E-07
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 16 370 3.0E-07
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 49 237 3.0E-07
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 49 376 4.0E-07
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 206 364 5.0E-07
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 49 265 6.0E-07
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 50 370 7.0E-07
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 49 372 4.0E-06
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 28 370 4.0E-06
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 50 227 6.0E-06
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 49 375 6.0E-06
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 37 375 7.0E-06
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 23 372 7.0E-06
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 49 270 8.0E-06
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 50 279 9.0E-06
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 62 376 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5684
MRSAISSLAVLPLASLAQAAPRGSAGSQGEGFVHMPLTYRAEDKFSTVDIGLGTPQQSVRVLVNTGSYTLWVNPS
CSARGTCPERTFVKQDSTTFKDLGRVKTEPYRERVTYRFATDKLSLGSVNLDNHLFGVGESFKIEQSSRRTELSE
ADDLHKLIPYGLMGISRVNASDPDGERASVLKSLLSGGHIRTEAFSLDVQGPEDDGSLIFGGVDVKKFSGPLQKI
PMLDDGKPSYNVKLDGVAVTKGGNTKVVSEGKISISLMTGTPVSILPDTIMNQVYDMYQEVNRQQPPHSLVCDFV
KDAEGTLDFRFGSVTIKVPIKELITPQNESFRGYCDFNIIPIVPQDGAYTLGNDILKHAYIVYDSAHSNVHIGNS
KNCGKKVVPLDADTNIDTLNGEC*
Coding >Hirsu2|5684
ATGCGGTCCGCAATCTCCTCGCTCGCGGTGCTCCCCCTCGCCTCCCTCGCCCAGGCTGCCCCCAGGGGCAGCGCG
GGATCGCAGGGCGAAGGCTTCGTGCACATGCCCCTGACGTACCGGGCCGAGGACAAGTTCTCGACCGTCGACATC
GGCCTCGGCACGCCGCAGCAGAGCGTGCGCGTGCTCGTCAACACCGGCTCCTATACGCTGTGGGTGAATCCGTCG
TGCAGCGCTCGCGGCACGTGCCCCGAGCGGACCTTTGTCAAGCAGGACAGCACCACGTTCAAGGACCTCGGCCGG
GTCAAGACCGAGCCGTACCGCGAGAGGGTCACGTACAGGTTCGCTACAGACAAGCTGAGCCTAGGCTCTGTCAAC
CTGGACAACCATCTCTTCGGCGTGGGCGAGAGCTTCAAGATCGAGCAGTCATCCAGGCGAACGGAGCTCTCGGAA
GCGGATGACTTGCACAAGCTCATCCCGTACGGCCTGATGGGCATCTCGCGCGTCAACGCCAGCGACCCGGACGGC
GAAAGGGCTTCGGTGCTCAAGTCCCTGCTCAGTGGCGGGCACATCAGGACCGAGGCATTCAGCCTCGATGTCCAG
GGCCCCGAAGATGACGGTTCTTTGATATTCGGCGGCGTCGACGTCAAGAAGTTCTCCGGCCCGTTACAGAAGATC
CCCATGCTCGACGACGGGAAGCCCTCTTACAATGTCAAGCTCGACGGCGTCGCCGTCACCAAAGGGGGCAACACC
AAGGTCGTTTCGGAGGGCAAGATCTCCATCAGCCTCATGACGGGCACTCCTGTCTCGATCCTCCCCGACACCATC
ATGAATCAAGTATACGACATGTACCAGGAAGTGAACAGGCAGCAGCCTCCTCACAGTCTGGTCTGCGACTTCGTC
AAGGACGCCGAGGGCACGCTCGACTTCCGGTTTGGAAGCGTCACCATCAAGGTGCCCATCAAGGAGCTCATCACG
CCCCAAAACGAAAGCTTCAGGGGTTACTGCGATTTCAACATCATTCCCATCGTGCCGCAAGACGGCGCCTACACG
CTCGGCAATGACATCCTCAAGCACGCCTACATCGTCTATGACTCGGCACATTCCAACGTCCATATCGGCAACTCC
AAGAATTGCGGAAAGAAGGTCGTCCCGCTCGATGCTGATACCAACATTGACACGCTCAACGGTGAATGTTAG
Transcript >Hirsu2|5684
ATGCGGTCCGCAATCTCCTCGCTCGCGGTGCTCCCCCTCGCCTCCCTCGCCCAGGCTGCCCCCAGGGGCAGCGCG
GGATCGCAGGGCGAAGGCTTCGTGCACATGCCCCTGACGTACCGGGCCGAGGACAAGTTCTCGACCGTCGACATC
GGCCTCGGCACGCCGCAGCAGAGCGTGCGCGTGCTCGTCAACACCGGCTCCTATACGCTGTGGGTGAATCCGTCG
TGCAGCGCTCGCGGCACGTGCCCCGAGCGGACCTTTGTCAAGCAGGACAGCACCACGTTCAAGGACCTCGGCCGG
GTCAAGACCGAGCCGTACCGCGAGAGGGTCACGTACAGGTTCGCTACAGACAAGCTGAGCCTAGGCTCTGTCAAC
CTGGACAACCATCTCTTCGGCGTGGGCGAGAGCTTCAAGATCGAGCAGTCATCCAGGCGAACGGAGCTCTCGGAA
GCGGATGACTTGCACAAGCTCATCCCGTACGGCCTGATGGGCATCTCGCGCGTCAACGCCAGCGACCCGGACGGC
GAAAGGGCTTCGGTGCTCAAGTCCCTGCTCAGTGGCGGGCACATCAGGACCGAGGCATTCAGCCTCGATGTCCAG
GGCCCCGAAGATGACGGTTCTTTGATATTCGGCGGCGTCGACGTCAAGAAGTTCTCCGGCCCGTTACAGAAGATC
CCCATGCTCGACGACGGGAAGCCCTCTTACAATGTCAAGCTCGACGGCGTCGCCGTCACCAAAGGGGGCAACACC
AAGGTCGTTTCGGAGGGCAAGATCTCCATCAGCCTCATGACGGGCACTCCTGTCTCGATCCTCCCCGACACCATC
ATGAATCAAGTATACGACATGTACCAGGAAGTGAACAGGCAGCAGCCTCCTCACAGTCTGGTCTGCGACTTCGTC
AAGGACGCCGAGGGCACGCTCGACTTCCGGTTTGGAAGCGTCACCATCAAGGTGCCCATCAAGGAGCTCATCACG
CCCCAAAACGAAAGCTTCAGGGGTTACTGCGATTTCAACATCATTCCCATCGTGCCGCAAGACGGCGCCTACACG
CTCGGCAATGACATCCTCAAGCACGCCTACATCGTCTATGACTCGGCACATTCCAACGTCCATATCGGCAACTCC
AAGAATTGCGGAAAGAAGGTCGTCCCGCTCGATGCTGATACCAACATTGACACGCTCAACGGTGAATGTTAG
Gene >Hirsu2|5684
ATGCGGTCCGCAATCTCCTCGCTCGCGGTGCTCCCCCTCGCCTCCCTCGCCCAGGCTGCCCCCAGGGGCAGCGCG
GGATCGCAGGGCGAAGGCTTCGTGCACATGCCCCTGACGTACCGGGCCGAGGACAAGTTCTCGACCGTCGACATC
GGCCTCGGCACGCCGCAGCAGAGCGTGCGCGTGCTCGTCAACACCGGCTCCTATACGCTGTGGGTGAATCCGTCG
TGCAGCGCTCGCGGCACGTGCCCCGAGCGGACCTTTGTCAAGCAGGACAGCACCACGTTCAAGGACCTCGGCCGG
GTCAAGACCGAGCCGTACCGCGAGAGGGTCACGTACAGGTTCGCTACAGACAAGCTGAGCCTAGGCTGTAGGTCC
CCCTGCATGAGAGACGAGTTCCTGTTATCCAAATGCGTTATGGCACTGTTCCGTCCATGCTACTGGAGGCCGGGA
ACTGACGCTCGTGGTCCCAAAATTGATCGCGCGCAGCTGTCAACCTGGACAACCATCTCTTCGGCGTGGGCGAGA
GCTTCAAGATCGAGCAGTCATCCAGGCGAACGGAGCTCTCGGAAGCGGATGACTTGCACAAGCTCATCCCGTACG
GCCTGATGGGCATCTCGCGCGTCAACGCCAGCGACCCGGACGGCGAAAGGGCTTCGGTGCTCAAGTCCCTGCTCA
GTGGCGGGCACATCAGGACCGAGGCATTCAGCCTCGATGTCCAGGGCCCCGAAGATGACGGTAGGATGCCCGTAT
ACCCGAGTCTACGGCCGAGAGGGTGAACGGCGTGCTAATTGATGGTCGGCTTCTCCCCGCAGGTTCTTTGATATT
CGGCGGCGTCGACGTCAAGAAGTTCTCCGGCCCGTTACAGAAGATCCCCATGCTCGACGACGGGAAGCCCTCGTA
AGTCTCACAGGCCCGCCGCAATGCACACAGTCTCGGGGGAGGGAAGGCGCTGAATAGGATGCATCATGTCCAGTT
ACAATGTCAAGCTCGACGGCGTCGCCGTCACCAAAGGGGGCAACACCAAGGTCGTTTCGGAGGGCAAGATCTCCA
TCAGCCTCATGACGGGCACTCCTGTCTCGATCCTCCCCGACACCATCATGAATCAAGTATACGACATGTACCAGG
AAGTGAACAGGCAGCAGCCTCCTCACAGTCTGGTCTGCGACTTCGTCAAGGACGCCGAGGGCACGCTCGACTTCC
GGTTTGGAAGCGTCACCATCAAGGTGCCCATCAAGGAGCTCATCACGCCCCAAAACGAAAGCTTCAGGGGTTACT
GCGATTTCAACATCATTCCCATCGTGCCGCAAGACGGTAGGCCATCCTGGGGAGCGACCGTGAAGGTACTCAGCG
GGCTAACGGGAGGAAACAGGCGCCTACACGCTCGGCAATGACATCCTCAAGCACGCCTACATCGTCTATGACTCG
GCACATTCCAACGTCCATATCGGCAACTCCAAGAATTGCGGAAAGAAGGTCGTCCCGCTCGATGCTGATACCAAC
ATTGACACGCTCAACGGTGAATGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail