Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5676
Gene name
LocationContig_285:23873..25426
Strand+
Gene length (bp)1553
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 5.1E-06 167 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9LZJ3|XXT1_ARATH Xyloglucan 6-xylosyltransferase 1 OS=Arabidopsis thaliana GN=XXT1 PE=1 SV=1 155 284 7.0E-08
sp|O22775|XXT2_ARATH Xyloglucan 6-xylosyltransferase 2 OS=Arabidopsis thaliana GN=XXT2 PE=1 SV=1 155 284 2.0E-07

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044425 membrane part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5676
MVFSGSVRSTRGTILLVGAVIFLTIFWGLFATSSDSWDLSSSHRTKFAFSHAPSAVPAKSVSPRPSPHAKPDHPG
DINVVQYASQLRKFFFEQLWRPSVEPTALHYRPFGAYNWKLPRPPQWNRPLGNDLCIIDLDTRPFDRPGQIFGPE
FMTWDNPLGVHGLSLGILNHWLYAKIHGYKYYYVAVSEPADRRSSWKKPPIMAKILKEHDVCLYLDSDAIFPRLD
LPFEWLLNYWQLFPGINSLALAVDPDLEPNKDRFGKLFLNTGFIVAQNNPKTYEILDAWQKCPDEGHPYPGCVEF
RYNEPGRPTDQGGFGTFVRYNFSDAIKELPCTEANGFPQNDWGCKGQFIRHLWTGKADQIKVDVGEQLPGPYLQL
FHQQFRDEQDEFYLTESALMSKGPKAAAKTAQFTKGAQGGGWHAPQHGAEAGNQPPTGSHREAGQEPRTGSEPKT
EQSAESRPPEHEPVPGSSEEDPINEENA*
Coding >Hirsu2|5676
ATGGTCTTCAGCGGCTCCGTGCGATCAACAAGGGGCACCATCCTCCTCGTAGGCGCCGTCATCTTTCTCACCATA
TTCTGGGGCCTTTTCGCTACCTCGTCAGACTCGTGGGACCTCTCCAGCTCACACAGGACCAAATTTGCCTTCTCG
CACGCACCCTCGGCTGTACCAGCCAAGTCAGTCTCGCCTCGCCCTTCTCCGCATGCCAAGCCGGACCACCCCGGT
GACATCAACGTCGTCCAATATGCTAGTCAGTTGCGCAAATTCTTCTTCGAGCAGCTCTGGAGACCGTCGGTTGAG
CCGACTGCCCTCCACTACCGCCCCTTCGGCGCCTACAATTGGAAGCTGCCTCGCCCTCCCCAATGGAACCGACCG
CTGGGCAACGATCTTTGCATCATCGACCTGGATACTCGCCCCTTCGACCGACCGGGCCAGATCTTTGGGCCCGAA
TTCATGACGTGGGATAATCCCCTCGGCGTCCATGGATTGTCCCTCGGCATACTCAACCACTGGCTCTACGCCAAG
ATTCATGGTTACAAGTATTACTACGTCGCCGTCAGCGAACCCGCCGACCGTCGGTCCTCGTGGAAGAAGCCACCC
ATCATGGCCAAGATCCTCAAGGAGCACGACGTCTGCCTGTACCTCGACTCGGACGCCATCTTCCCTCGCCTCGAC
CTGCCTTTTGAGTGGCTGCTCAACTACTGGCAACTGTTTCCCGGGATAAACTCGCTCGCCCTCGCCGTCGATCCC
GACCTGGAGCCCAACAAAGACAGGTTTGGCAAGCTTTTCCTGAACACGGGCTTCATCGTCGCGCAGAACAATCCC
AAGACATACGAAATCCTCGATGCCTGGCAGAAATGTCCCGACGAGGGGCACCCTTACCCGGGCTGCGTCGAATTT
CGCTACAACGAGCCCGGTCGACCGACCGACCAGGGCGGTTTCGGCACCTTTGTCCGCTACAACTTTAGTGACGCC
ATCAAGGAGCTCCCTTGCACCGAGGCCAACGGGTTTCCGCAGAACGACTGGGGCTGCAAGGGCCAGTTCATTCGC
CACCTGTGGACGGGCAAGGCGGACCAGATCAAGGTCGACGTGGGCGAGCAGCTTCCCGGCCCCTATCTTCAGCTT
TTCCATCAGCAGTTCAGGGACGAACAGGATGAGTTTTATCTCACCGAATCCGCCTTGATGAGCAAGGGACCCAAA
GCAGCGGCAAAGACGGCTCAGTTCACAAAGGGCGCGCAGGGCGGAGGCTGGCACGCGCCCCAACACGGAGCAGAG
GCGGGGAACCAGCCGCCAACGGGCTCGCACAGGGAGGCCGGCCAGGAACCCCGAACCGGCAGCGAACCCAAGACG
GAACAATCCGCCGAGAGCCGGCCACCCGAGCACGAACCAGTGCCTGGAAGCAGTGAAGAAGATCCGATTAACGAA
GAGAACGCATAG
Transcript >Hirsu2|5676
ATGGTCTTCAGCGGCTCCGTGCGATCAACAAGGGGCACCATCCTCCTCGTAGGCGCCGTCATCTTTCTCACCATA
TTCTGGGGCCTTTTCGCTACCTCGTCAGACTCGTGGGACCTCTCCAGCTCACACAGGACCAAATTTGCCTTCTCG
CACGCACCCTCGGCTGTACCAGCCAAGTCAGTCTCGCCTCGCCCTTCTCCGCATGCCAAGCCGGACCACCCCGGT
GACATCAACGTCGTCCAATATGCTAGTCAGTTGCGCAAATTCTTCTTCGAGCAGCTCTGGAGACCGTCGGTTGAG
CCGACTGCCCTCCACTACCGCCCCTTCGGCGCCTACAATTGGAAGCTGCCTCGCCCTCCCCAATGGAACCGACCG
CTGGGCAACGATCTTTGCATCATCGACCTGGATACTCGCCCCTTCGACCGACCGGGCCAGATCTTTGGGCCCGAA
TTCATGACGTGGGATAATCCCCTCGGCGTCCATGGATTGTCCCTCGGCATACTCAACCACTGGCTCTACGCCAAG
ATTCATGGTTACAAGTATTACTACGTCGCCGTCAGCGAACCCGCCGACCGTCGGTCCTCGTGGAAGAAGCCACCC
ATCATGGCCAAGATCCTCAAGGAGCACGACGTCTGCCTGTACCTCGACTCGGACGCCATCTTCCCTCGCCTCGAC
CTGCCTTTTGAGTGGCTGCTCAACTACTGGCAACTGTTTCCCGGGATAAACTCGCTCGCCCTCGCCGTCGATCCC
GACCTGGAGCCCAACAAAGACAGGTTTGGCAAGCTTTTCCTGAACACGGGCTTCATCGTCGCGCAGAACAATCCC
AAGACATACGAAATCCTCGATGCCTGGCAGAAATGTCCCGACGAGGGGCACCCTTACCCGGGCTGCGTCGAATTT
CGCTACAACGAGCCCGGTCGACCGACCGACCAGGGCGGTTTCGGCACCTTTGTCCGCTACAACTTTAGTGACGCC
ATCAAGGAGCTCCCTTGCACCGAGGCCAACGGGTTTCCGCAGAACGACTGGGGCTGCAAGGGCCAGTTCATTCGC
CACCTGTGGACGGGCAAGGCGGACCAGATCAAGGTCGACGTGGGCGAGCAGCTTCCCGGCCCCTATCTTCAGCTT
TTCCATCAGCAGTTCAGGGACGAACAGGATGAGTTTTATCTCACCGAATCCGCCTTGATGAGCAAGGGACCCAAA
GCAGCGGCAAAGACGGCTCAGTTCACAAAGGGCGCGCAGGGCGGAGGCTGGCACGCGCCCCAACACGGAGCAGAG
GCGGGGAACCAGCCGCCAACGGGCTCGCACAGGGAGGCCGGCCAGGAACCCCGAACCGGCAGCGAACCCAAGACG
GAACAATCCGCCGAGAGCCGGCCACCCGAGCACGAACCAGTGCCTGGAAGCAGTGAAGAAGATCCGATTAACGAA
GAGAACGCATAG
Gene >Hirsu2|5676
ATGGTCTTCAGCGGCTCCGTGCGATCAACAAGGGGCACCATCCTCCTCGTAGGCGCCGTCATCTTTCTCACCATA
TTCTGGGGCCTTTTCGCTACCTCGTCAGACTCGTGGGACCTCTCCAGGTTTGTCGTCTTGCCCTTCGCCGTCCGA
GAAGCGACGCTGACGTTGTCGGGAAAGCTCACACAGGACCAAATTTGCCTTCTCGCACGCACCCTCGGCTGTACC
AGCCAAGTCAGTCTCGCCTCGCCCTTCTCCGCATGCCAAGCCGGACCACCCCGGTGACATCAACGTCGTCCAATA
TGCTAGTCAGTTGCGCAAATTCTTCTTCGAGCAGCTCTGGAGACCGTCGGTTGAGCCGACTGCCCTCCACTACCG
CCCCTTCGGCGCCTACAATTGGAAGCTGCCTCGCCCTCCCCAATGGAACCGACCGCTGGGCAACGATCTTTGCAT
CATCGACCTGGATACTCGCCCCTTCGACCGACCGGGCCAGATCTTTGGGCCCGAATTCATGACGTGGGATAATCC
CCTCGGCGTCCATGGATTGTCCCTCGGCATACTCAACCACTGGCTCTACGGTACGCCTCGCGCCCTTGCCTCAAC
TCACCCCGCCCAGCTGACATTGCCTCGGCCTCAAAGCCAAGATTCATGGTTACAAGTATTACTACGTCGCCGTCA
GCGAACCCGCCGACCGTCGGTCCTCGTGGAAGAAGCCACCCATCATGGCCAAGATCCTCAAGGAGCACGACGTCT
GCCTGTACCTCGACTCGGACGCCATCTTCCCTCGCCTCGACCTGCCTTTTGAGTGGCTGCTCAACTACTGGCAAC
TGTTTCCCGGGATAAACTCGCTCGCCCTCGCCGTCGATCCCGACCTGGAGCCCAACAAAGACAGGTTTGGCAAGC
TTTTCCTGAACACGGGCTTCATCGTCGCGCAGAACAATCCCAAGACATACGAAATCCTCGATGCCTGGCAGAAAT
GTCCCGACGAGGGGCACCCTTACCCGGGCTGCGTCGAATTTCGCTACAACGAGCCCGGTCGACCGACCGACCAGG
GCGGTTTCGGCACCTTTGTCCGCTACAACTTTAGTGACGCCATCAAGGAGCTCCCTTGCACCGAGGCCAACGGGT
TTCCGCAGAACGACTGGGGCTGCAAGGGCCAGTTCATTCGCCACCTGTGGACGGGCAAGGCGGACCAGATCAAGG
TCGACGTGGGCGAGCAGCTTCCCGGCCCCTATCTTCAGCTTTTCCATCAGCAGTTCAGGGACGAACAGGATGAGT
TTTATCTCACCGAATCCGCCTTGATGAGCAAGGGACCCAAAGCAGCGGCAAAGACGGCTCAGTTCACAAAGGGCG
CGCAGGGCGGAGGCTGGCACGCGCCCCAACACGGAGCAGAGGCGGGGAACCAGCCGCCAACGGGCTCGCACAGGG
AGGCCGGCCAGGAACCCCGAACCGGCAGCGAACCCAAGACGGAACAATCCGCCGAGAGCCGGCCACCCGAGCACG
AACCAGTGCCTGGAAGCAGTGAAGAAGATCCGATTAACGAAGAGAACGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail