Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5674
Gene name
LocationContig_285:12016..12691
Strand+
Gene length (bp)675
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04862 DUF642 Protein of unknown function (DUF642) 3.7E-06 127 222

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Extracellular 0.3779 0.5788 0.9069 0.1072 0.2461 0.025 0.0148 0.1819 0.1342 0.0086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4177
Ophiocordyceps australis map64 (Brazil) OphauB2|6260
Ophiocordyceps camponoti-floridani Ophcf2|04329
Ophiocordyceps camponoti-rufipedis Ophun1|3726
Ophiocordyceps kimflemingae Ophio5|1611
Ophiocordyceps subramaniannii Hirsu2|3955
Ophiocordyceps subramaniannii Hirsu2|5674 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5674
MVDRRIQRFNVQLKTAVEELRSQGLPLSYVDMYSALTLNDLADVVHPNDSGYNKMAQVWMKALRKVLPAPGKRIV
QHNPHFQTTHSVPGRSFNSTYIPMWLNRGIVIVQAESNTDLNAVAPYTGHPGISATFAVSAGRPVTVTYRVRDSL
GMGGCAASRSRTLKLAFDTDPKGNRVTTGSTSDWKQHTYKFTSTSTAATLTITALGREPNVCGPMIADVVVRQG*
Coding >Hirsu2|5674
ATGGTCGATCGTAGGATCCAGAGATTCAATGTGCAGCTCAAGACCGCTGTCGAAGAGCTTCGGAGCCAGGGTCTT
CCATTGTCTTACGTCGATATGTACAGCGCCCTCACGCTCAACGACCTTGCCGATGTCGTTCACCCAAACGACAGC
GGGTACAACAAGATGGCCCAGGTGTGGATGAAAGCGCTGAGAAAGGTCTTGCCCGCGCCCGGGAAGAGGATCGTT
CAGCACAACCCGCATTTTCAGACGACACATAGTGTCCCAGGCCGGAGCTTCAACTCCACTTATATACCCATGTGG
CTGAATAGGGGAATCGTCATCGTACAGGCCGAGAGTAACACCGACCTCAACGCCGTGGCGCCGTACACCGGGCAT
CCCGGCATCAGCGCCACCTTTGCCGTTTCCGCCGGCAGGCCCGTGACCGTAACCTACCGCGTGAGAGACAGCCTA
GGCATGGGAGGCTGCGCGGCCTCCCGTTCGCGCACACTCAAGCTGGCGTTCGATACGGATCCGAAAGGGAATCGG
GTGACGACAGGCTCGACATCGGACTGGAAACAACACACCTACAAATTCACTTCGACATCTACCGCTGCTACTCTG
ACCATCACTGCCCTGGGAAGGGAGCCCAATGTGTGTGGTCCCATGATTGCCGACGTCGTGGTGCGACAAGGCTGA
Transcript >Hirsu2|5674
ATGGTCGATCGTAGGATCCAGAGATTCAATGTGCAGCTCAAGACCGCTGTCGAAGAGCTTCGGAGCCAGGGTCTT
CCATTGTCTTACGTCGATATGTACAGCGCCCTCACGCTCAACGACCTTGCCGATGTCGTTCACCCAAACGACAGC
GGGTACAACAAGATGGCCCAGGTGTGGATGAAAGCGCTGAGAAAGGTCTTGCCCGCGCCCGGGAAGAGGATCGTT
CAGCACAACCCGCATTTTCAGACGACACATAGTGTCCCAGGCCGGAGCTTCAACTCCACTTATATACCCATGTGG
CTGAATAGGGGAATCGTCATCGTACAGGCCGAGAGTAACACCGACCTCAACGCCGTGGCGCCGTACACCGGGCAT
CCCGGCATCAGCGCCACCTTTGCCGTTTCCGCCGGCAGGCCCGTGACCGTAACCTACCGCGTGAGAGACAGCCTA
GGCATGGGAGGCTGCGCGGCCTCCCGTTCGCGCACACTCAAGCTGGCGTTCGATACGGATCCGAAAGGGAATCGG
GTGACGACAGGCTCGACATCGGACTGGAAACAACACACCTACAAATTCACTTCGACATCTACCGCTGCTACTCTG
ACCATCACTGCCCTGGGAAGGGAGCCCAATGTGTGTGGTCCCATGATTGCCGACGTCGTGGTGCGACAAGGCTGA
Gene >Hirsu2|5674
ATGGTCGATCGTAGGATCCAGAGATTCAATGTGCAGCTCAAGACCGCTGTCGAAGAGCTTCGGAGCCAGGGTCTT
CCATTGTCTTACGTCGATATGTACAGCGCCCTCACGCTCAACGACCTTGCCGATGTCGTTCACCCAAACGACAGC
GGGTACAACAAGATGGCCCAGGTGTGGATGAAAGCGCTGAGAAAGGTCTTGCCCGCGCCCGGGAAGAGGATCGTT
CAGCACAACCCGCATTTTCAGACGACACATAGTGTCCCAGGCCGGAGCTTCAACTCCACTTATATACCCATGTGG
CTGAATAGGGGAATCGTCATCGTACAGGCCGAGAGTAACACCGACCTCAACGCCGTGGCGCCGTACACCGGGCAT
CCCGGCATCAGCGCCACCTTTGCCGTTTCCGCCGGCAGGCCCGTGACCGTAACCTACCGCGTGAGAGACAGCCTA
GGCATGGGAGGCTGCGCGGCCTCCCGTTCGCGCACACTCAAGCTGGCGTTCGATACGGATCCGAAAGGGAATCGG
GTGACGACAGGCTCGACATCGGACTGGAAACAACACACCTACAAATTCACTTCGACATCTACCGCTGCTACTCTG
ACCATCACTGCCCTGGGAAGGGAGCCCAATGTGTGTGGTCCCATGATTGCCGACGTCGTGGTGCGACAAGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail