Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5673
Gene name
LocationContig_285:6953..8060
Strand+
Gene length (bp)1107
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.568 0.6499 0.1265 0.0935 0.2672 0.0115 0.1081 0.1561 0.0493 0.0415

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576
Ophiocordyceps camponoti-rufipedis Ophun1|7602
Ophiocordyceps kimflemingae Ophio5|2612
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5673
MTGRLSSDSFQKASSFIRSTRIPDAESWIRGLERGSADAAATLLVSLLPNLRSLFIGPGFSRQCSFLGKLLMYIL
YRPPHLRPRPLLPAFEQLSHVSLCHLRKAQTRHSPMHVLPFFYLPNIRNLSVCIDSPSRFVWSTRAPDPSSLTSL
ELSRLKEGLEPLLGVLSRLQSLCWIWPFHVYTDQNPDAARDVLDLGVLRHASETLRKLAIGVEPITIGDRSGDLH
MIQPKIRGSISGLANLSQLTVLCLPWALLMGFGPSQDIRFEERLPRQLENLKLSASMIDCEGWEWDTNDVIDALR
SGLEIQKRPFWPRLRLIGLFLRENAKNREYLELRDLDLTEETGKELVVIGARVGVTIRIPRQDTEPQR*
Coding >Hirsu2|5673
ATGACCGGCAGGCTTTCCTCGGATTCGTTCCAAAAAGCATCAAGTTTCATCCGCTCGACCCGAATACCAGATGCC
GAGTCTTGGATACGAGGTCTCGAACGAGGGTCCGCCGACGCCGCCGCCACGCTGCTCGTATCGCTGTTGCCGAAT
CTGAGGTCACTCTTCATCGGACCCGGGTTTTCACGCCAATGTTCATTCCTGGGCAAGCTGCTCATGTATATCCTC
TACAGGCCCCCTCACTTGCGGCCTCGACCTCTGCTGCCTGCGTTCGAACAGCTAAGCCATGTGTCGCTCTGCCAT
CTGAGAAAGGCTCAAACGCGGCATAGTCCGATGCATGTCCTCCCTTTCTTCTACCTCCCGAACATACGAAACCTT
TCTGTCTGCATCGACAGCCCCTCGCGGTTCGTCTGGTCCACAAGAGCGCCGGACCCCTCATCACTCACCTCACTA
GAGCTTTCCCGACTGAAGGAAGGGCTCGAGCCGCTTCTTGGGGTCCTCAGTCGCTTGCAATCTCTCTGCTGGATC
TGGCCTTTTCACGTCTACACCGACCAGAACCCTGATGCGGCCAGAGATGTTCTTGACCTTGGTGTCCTGCGCCAC
GCGAGCGAAACCCTGAGAAAGCTGGCCATTGGGGTCGAGCCAATCACAATTGGTGACCGTTCGGGAGACCTCCAT
ATGATTCAGCCCAAGATTCGGGGGTCCATATCTGGCTTGGCTAACCTCAGCCAACTGACCGTACTGTGCCTGCCC
TGGGCTTTGCTGATGGGCTTCGGGCCGTCCCAAGACATCCGCTTTGAAGAAAGGCTCCCGCGGCAACTAGAAAAC
CTCAAATTGTCGGCCAGCATGATCGACTGTGAGGGTTGGGAATGGGACACCAATGACGTTATTGACGCGCTGCGA
TCCGGGCTTGAGATTCAAAAAAGGCCATTCTGGCCGAGGCTGCGGCTCATCGGGCTGTTCCTTCGGGAGAATGCG
AAGAATCGGGAGTATCTAGAATTGAGAGATCTGGACCTGACAGAAGAAACAGGAAAAGAGCTCGTGGTGATCGGT
GCCAGAGTTGGAGTCACGATCAGGATTCCTCGTCAGGACACGGAGCCACAAAGATGA
Transcript >Hirsu2|5673
ATGACCGGCAGGCTTTCCTCGGATTCGTTCCAAAAAGCATCAAGTTTCATCCGCTCGACCCGAATACCAGATGCC
GAGTCTTGGATACGAGGTCTCGAACGAGGGTCCGCCGACGCCGCCGCCACGCTGCTCGTATCGCTGTTGCCGAAT
CTGAGGTCACTCTTCATCGGACCCGGGTTTTCACGCCAATGTTCATTCCTGGGCAAGCTGCTCATGTATATCCTC
TACAGGCCCCCTCACTTGCGGCCTCGACCTCTGCTGCCTGCGTTCGAACAGCTAAGCCATGTGTCGCTCTGCCAT
CTGAGAAAGGCTCAAACGCGGCATAGTCCGATGCATGTCCTCCCTTTCTTCTACCTCCCGAACATACGAAACCTT
TCTGTCTGCATCGACAGCCCCTCGCGGTTCGTCTGGTCCACAAGAGCGCCGGACCCCTCATCACTCACCTCACTA
GAGCTTTCCCGACTGAAGGAAGGGCTCGAGCCGCTTCTTGGGGTCCTCAGTCGCTTGCAATCTCTCTGCTGGATC
TGGCCTTTTCACGTCTACACCGACCAGAACCCTGATGCGGCCAGAGATGTTCTTGACCTTGGTGTCCTGCGCCAC
GCGAGCGAAACCCTGAGAAAGCTGGCCATTGGGGTCGAGCCAATCACAATTGGTGACCGTTCGGGAGACCTCCAT
ATGATTCAGCCCAAGATTCGGGGGTCCATATCTGGCTTGGCTAACCTCAGCCAACTGACCGTACTGTGCCTGCCC
TGGGCTTTGCTGATGGGCTTCGGGCCGTCCCAAGACATCCGCTTTGAAGAAAGGCTCCCGCGGCAACTAGAAAAC
CTCAAATTGTCGGCCAGCATGATCGACTGTGAGGGTTGGGAATGGGACACCAATGACGTTATTGACGCGCTGCGA
TCCGGGCTTGAGATTCAAAAAAGGCCATTCTGGCCGAGGCTGCGGCTCATCGGGCTGTTCCTTCGGGAGAATGCG
AAGAATCGGGAGTATCTAGAATTGAGAGATCTGGACCTGACAGAAGAAACAGGAAAAGAGCTCGTGGTGATCGGT
GCCAGAGTTGGAGTCACGATCAGGATTCCTCGTCAGGACACGGAGCCACAAAGATGA
Gene >Hirsu2|5673
ATGACCGGCAGGCTTTCCTCGGATTCGTTCCAAAAAGCATCAAGTTTCATCCGCTCGACCCGAATACCAGATGCC
GAGTCTTGGATACGAGGTCTCGAACGAGGGTCCGCCGACGCCGCCGCCACGCTGCTCGTATCGCTGTTGCCGAAT
CTGAGGTCACTCTTCATCGGACCCGGGTTTTCACGCCAATGTTCATTCCTGGGCAAGCTGCTCATGTATATCCTC
TACAGGCCCCCTCACTTGCGGCCTCGACCTCTGCTGCCTGCGTTCGAACAGCTAAGCCATGTGTCGCTCTGCCAT
CTGAGAAAGGCTCAAACGCGGCATAGTCCGATGCATGTCCTCCCTTTCTTCTACCTCCCGAACATACGAAACCTT
TCTGTCTGCATCGACAGCCCCTCGCGGTTCGTCTGGTCCACAAGAGCGCCGGACCCCTCATCACTCACCTCACTA
GAGCTTTCCCGACTGAAGGAAGGGCTCGAGCCGCTTCTTGGGGTCCTCAGTCGCTTGCAATCTCTCTGCTGGATC
TGGCCTTTTCACGTCTACACCGACCAGAACCCTGATGCGGCCAGAGATGTTCTTGACCTTGGTGTCCTGCGCCAC
GCGAGCGAAACCCTGAGAAAGCTGGCCATTGGGGTCGAGCCAATCACAATTGGTGACCGTTCGGGAGACCTCCAT
ATGATTCAGCCCAAGATTCGGGGGTCCATATCTGGCTTGGCTAACCTCAGCCAACTGACCGTACTGTGCCTGCCC
TGGGCTTTGCTGATGGGCTTCGGGCCGTCCCAAGACATCCGCTTTGAAGAAAGGCTCCCGCGGCAACTAGAAAAC
CTCAAATTGTCGGCCAGCATGATCGACTGTGAGGGTTGGGAATGGGACACCAATGACGTTATTGACGCGCTGCGA
TCCGGGCTTGAGATTCAAAAAAGGCCATTCTGGCCGAGGCTGCGGCTCATCGGGCTGTTCCTTCGGGAGAATGCG
AAGAATCGGGAGTATCTAGAATTGAGAGATCTGGACCTGACAGAAGAAACAGGAAAAGAGCTCGTGGTGATCGGT
GCCAGAGTTGGAGTCACGATCAGGATTCCTCGTCAGGACACGGAGCCACAAAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail