Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5669
Gene name
LocationContig_285:595..1991
Strand-
Gene length (bp)1396
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.4E-17 7 312
PF07690 MFS_1 Major Facilitator Superfamily 7.7E-09 235 380

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 2 360 4.0E-19

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 47 69 22
3 76 98 22
4 113 135 22
5 195 217 22
6 227 249 22
7 256 278 22
8 283 305 22
9 318 340 22
10 345 367 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5669
MDQTPPLSPLLETDFRLTYTVVSLVFLSPFVGYTLASAVNNLVHVRLGQRGVACLAPAFHLVPFLAISFRPPYPA
LVVLYTLVGFGNGLTDAAWCAWIGNMADTHEVTGLLQASYALGATVAPLLATAMISQAGLGWWSFHYVMVGASAV
ELVSCASTFWAQTGAVYLAENPHPQHGTTARSGRTLQALSNKFTWLFSLFIFLYNGAEVSLGGWLVVFMTKVRHA
SSFAGGATATGFWGGMTAGRLVLSLVTARLGEFRAMILYLALAIAVELVFWLVPHMVVSAVAAALLGLITGPMYP
TAIVLMTKLLPRALHVSALGFATAFGGSGAAILPFAVGAIAQARGVQSLQPIVLAICVVLAVIWGVVHHLDPRKK
KEDVSVGVGSSETI*
Coding >Hirsu2|5669
ATGGACCAAACTCCCCCCCTGAGCCCCTTGCTGGAGACGGACTTCCGGCTGACGTACACGGTCGTCTCGCTCGTC
TTCCTCTCGCCCTTCGTCGGCTACACGCTGGCCTCGGCCGTCAACAACCTGGTGCACGTCCGGCTGGGCCAGCGC
GGCGTCGCCTGCCTGGCGCCGGCCTTCCACCTCGTGCCCTTCCTGGCCATCTCCTTCCGGCCGCCGTACCCGGCG
CTGGTGGTGCTGTACACGCTGGTCGGCTTCGGCAACGGCCTCACCGACGCCGCCTGGTGCGCCTGGATCGGCAAC
ATGGCCGACACGCACGAGGTCACCGGCCTTCTGCAGGCGAGCTATGCCCTGGGCGCGACCGTCGCTCCGCTCCTC
GCCACGGCCATGATCTCGCAGGCAGGTCTGGGCTGGTGGTCGTTCCACTACGTCATGGTCGGAGCCTCGGCCGTC
GAGCTCGTCAGCTGCGCCAGCACCTTCTGGGCCCAGACCGGCGCCGTCTACCTGGCCGAGAACCCGCACCCGCAG
CACGGGACGACGGCCCGGTCCGGGCGCACGCTGCAGGCCCTGAGCAACAAGTTCACCTGGCTCTTCTCGCTCTTC
ATCTTCCTCTACAACGGCGCCGAGGTCTCGCTCGGCGGCTGGCTCGTCGTCTTCATGACCAAGGTCCGGCACGCC
TCCTCCTTCGCCGGCGGCGCCACCGCCACCGGCTTCTGGGGCGGCATGACGGCCGGCCGCCTCGTCCTCTCCCTC
GTCACCGCCCGCCTGGGCGAGTTTCGCGCCATGATCCTATATCTCGCTCTGGCCATCGCCGTCGAGCTGGTCTTC
TGGCTGGTCCCGCACATGGTCGTCAGTGCCGTTGCGGCGGCGCTTCTCGGCCTCATCACCGGGCCCATGTATCCC
ACGGCCATCGTGCTCATGACGAAGCTGCTCCCCCGGGCCCTGCATGTCAGCGCCCTGGGCTTCGCCACGGCCTTT
GGCGGCTCTGGCGCGGCCATCCTGCCCTTTGCGGTGGGTGCCATCGCTCAGGCCAGAGGCGTGCAGTCGCTGCAG
CCCATCGTCCTCGCCATCTGCGTAGTGCTAGCTGTCATCTGGGGCGTGGTGCACCATCTTGATCCTCGAAAGAAA
AAGGAAGACGTAAGCGTCGGGGTCGGGTCCTCGGAGACGATATAG
Transcript >Hirsu2|5669
ATGGACCAAACTCCCCCCCTGAGCCCCTTGCTGGAGACGGACTTCCGGCTGACGTACACGGTCGTCTCGCTCGTC
TTCCTCTCGCCCTTCGTCGGCTACACGCTGGCCTCGGCCGTCAACAACCTGGTGCACGTCCGGCTGGGCCAGCGC
GGCGTCGCCTGCCTGGCGCCGGCCTTCCACCTCGTGCCCTTCCTGGCCATCTCCTTCCGGCCGCCGTACCCGGCG
CTGGTGGTGCTGTACACGCTGGTCGGCTTCGGCAACGGCCTCACCGACGCCGCCTGGTGCGCCTGGATCGGCAAC
ATGGCCGACACGCACGAGGTCACCGGCCTTCTGCAGGCGAGCTATGCCCTGGGCGCGACCGTCGCTCCGCTCCTC
GCCACGGCCATGATCTCGCAGGCAGGTCTGGGCTGGTGGTCGTTCCACTACGTCATGGTCGGAGCCTCGGCCGTC
GAGCTCGTCAGCTGCGCCAGCACCTTCTGGGCCCAGACCGGCGCCGTCTACCTGGCCGAGAACCCGCACCCGCAG
CACGGGACGACGGCCCGGTCCGGGCGCACGCTGCAGGCCCTGAGCAACAAGTTCACCTGGCTCTTCTCGCTCTTC
ATCTTCCTCTACAACGGCGCCGAGGTCTCGCTCGGCGGCTGGCTCGTCGTCTTCATGACCAAGGTCCGGCACGCC
TCCTCCTTCGCCGGCGGCGCCACCGCCACCGGCTTCTGGGGCGGCATGACGGCCGGCCGCCTCGTCCTCTCCCTC
GTCACCGCCCGCCTGGGCGAGTTTCGCGCCATGATCCTATATCTCGCTCTGGCCATCGCCGTCGAGCTGGTCTTC
TGGCTGGTCCCGCACATGGTCGTCAGTGCCGTTGCGGCGGCGCTTCTCGGCCTCATCACCGGGCCCATGTATCCC
ACGGCCATCGTGCTCATGACGAAGCTGCTCCCCCGGGCCCTGCATGTCAGCGCCCTGGGCTTCGCCACGGCCTTT
GGCGGCTCTGGCGCGGCCATCCTGCCCTTTGCGGTGGGTGCCATCGCTCAGGCCAGAGGCGTGCAGTCGCTGCAG
CCCATCGTCCTCGCCATCTGCGTAGTGCTAGCTGTCATCTGGGGCGTGGTGCACCATCTTGATCCTCGAAAGAAA
AAGGAAGACGTAAGCGTCGGGGTCGGGTCCTCGGAGACGATATAG
Gene >Hirsu2|5669
ATGGACCAAACTCCCCCCCTGAGCCCCTTGGTTTGACGCTCGCTCGCTGACGGGACACGCCATGTCTTGATAGCT
GGAGACGGACTTCCGGCTGACGTACACGGTCGTCTCGCTCGTCTTCCTCTCGCCCTTCGTCGGCTACACGCTGGC
CTCGGCCGTCAACAACCTGGTGCACGTCCGGCTGGGCCAGCGCGGCGTCGCCTGCCTGGCGCCGGCCTTCCACCT
CGTGCCCTTCCTGGCCATCTCCTTCCGGCCGCCGTACCCGGCGCTGGTGGTGCTGTACACGCTGGTCGGCTTCGG
CAACGGCCTCACCGACGCCGCCTGGTGCGCCTGGATCGGCAACATGGCCGACACGCACGAGGTCACCGGCCTTCT
GCAGGCGAGCTATGCCCTGGGCGCGACCGTCGCTCCGCTCCTCGCCACGGCCATGATCTCGCAGGCAGGTCTGGG
CTGGTGGTCGTTCCACTACGTCATGGTATGTGCAATGAGCCAGCCCCTTGCTTGAACCCTTCCTCTCTCCCTTTC
TCTCAAGCCCTGAAAGTCTCGGCTTGACCGTTGATGATTTCCCGGCTTCAGGTCGGAGCCTCGGCCGTCGAGCTC
GTCAGCTGCGCCAGCACCTTCTGGGCCCAGACCGGCGCCGTCTACCTGGCCGAGAACCCGCACCCGCAGCACGGG
ACGACGGCCCGGTCCGGGCGCACGCTGCAGGCCCTGAGCAACAAGTTCACCTGGCTCTTCTCGCTCTTCATCTTC
CTCTACAACGGCGCCGAGGTCTCGCTCGGCGGCTGGCTCGTCGTCTTCATGACCAAGGTCCGGCACGCCTCCTCC
TTCGCCGGCGGCGCCACCGCCACCGGCTTCTGGGGCGGCATGACGGCCGGCCGCCTCGTCCTCTCCCTCGTCACC
GCCCGCCTGGGCGAGTTTCGCGCCATGATCCTATATCTCGCTCTGGCCATCGCCGTCGAGCTGGTCTTCTGGCTG
GTCCCGCACATGGTCGTCAGTGCCGTTGCGGCGGCGCTTCTCGGCCTCATCACCGGTACGTTTCGACCAGTCTAC
GTTACTTGTATATTCAGTTGCTGTCCTTTTCGAGGCGCATCCGGCTGACGGAGATTGCAAAGGGCCCATGTATCC
CACGGCCATCGTGCTCATGACGAAGCTGCTCCCCCGGGCCCTGCATGTCAGCGCCCTGGGCTTCGCCACGGCCTT
TGGCGGCTCTGGCGCGGCCATCCTGCCCTTTGCGGTGGGTGCCATCGCTCAGGCCAGAGGCGTGCAGTCGCTGCA
GCCCATCGTCCTCGCCATCTGCGTAGTGCTAGCTGTCATCTGGGGCGTGGTGCACCATCTTGATCCTCGAAAGAA
AAAGGAAGACGTAAGCGTCGGGGTCGGGTCCTCGGAGACGATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail