Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5656
Gene name
LocationContig_284:15035..15666
Strand+
Gene length (bp)631
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.4E-19 19 144
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 9.0E-07 51 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 1 183 5.0E-23
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 1 183 6.0E-22
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 1 183 3.0E-21
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 1 183 7.0E-21
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 1 182 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 1 183 5.0E-23
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 1 183 6.0E-22
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 1 183 3.0E-21
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 1 183 7.0E-21
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 1 182 3.0E-20
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 1 180 3.0E-18
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 1 180 3.0E-18
sp|Q40976|CADH_PINRA Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 7 180 8.0E-16
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 1 180 2.0E-15
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 12 182 2.0E-15
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 12 182 2.0E-15
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 12 182 2.0E-15
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 1 180 2.0E-15
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 9 180 1.0E-14
sp|P48523|CADH4_ARATH Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1 22 182 1.0E-13
sp|P30359|CADH1_TOBAC Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1 22 180 5.0E-13
sp|P31656|CADH_MEDSA Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 22 183 2.0E-12
sp|Q2R114|CADH4_ORYSJ Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CAD4 PE=3 SV=2 1 183 3.0E-12
sp|P31657|CADH_POPDE Probable cinnamyl alcohol dehydrogenase OS=Populus deltoides PE=2 SV=2 22 180 3.0E-12
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 1 180 8.0E-12
sp|P30360|CADH2_TOBAC Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1 22 182 1.0E-11
sp|O49482|CADH5_ARATH Cinnamyl alcohol dehydrogenase 5 OS=Arabidopsis thaliana GN=CAD5 PE=1 SV=1 22 183 1.0E-11
sp|Q8H859|CADH1_ORYSJ Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1 1 183 2.0E-11
sp|O82056|CADH_SACOF Probable cinnamyl alcohol dehydrogenase OS=Saccharum officinarum GN=CAD PE=2 SV=1 8 182 2.0E-11
sp|Q2KNL5|CADH1_OCIBA Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1 22 182 2.0E-11
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 1 144 5.0E-11
sp|P42495|CADH1_ARACO Probable cinnamyl alcohol dehydrogenase 1 OS=Aralia cordata GN=CAD1 PE=2 SV=1 22 180 6.0E-11
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 1 182 7.0E-11
sp|Q2FJ31|ADH_STAA3 Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 1 180 2.0E-10
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1 180 2.0E-10
sp|Q2G0G1|ADH_STAA8 Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q2YSX0|ADH_STAAB Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q5HI63|ADH_STAAC Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q6GJ63|ADH_STAAR Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q6GBM4|ADH_STAAS Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|Q8NXU1|ADH_STAAW Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 1 180 2.0E-10
sp|P31655|CADH2_EUCGU Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 22 182 4.0E-10
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 1 180 4.0E-10
sp|Q2KNL6|GEDH1_OCIBA Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1 22 183 4.0E-10
sp|P50746|CADH_EUCBO Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus botryoides GN=CAD1 PE=3 SV=1 22 182 4.0E-10
sp|O64969|CADH_EUCGL Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 22 182 4.0E-10
sp|O65621|CADH6_ARATH Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1 22 183 5.0E-10
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 1 180 6.0E-10
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1 180 7.0E-10
sp|Q42726|CADH1_EUCGU Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1 22 182 7.0E-10
sp|P75691|YAHK_ECOLI Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 22 180 1.0E-09
sp|Q9CAI3|CADH1_ARATH Probable cinnamyl alcohol dehydrogenase 1 OS=Arabidopsis thaliana GN=CAD1 PE=2 SV=1 1 183 1.0E-09
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 1 58 3.0E-09
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 1 58 3.0E-09
sp|O22380|CADH_LOLPR Probable cinnamyl alcohol dehydrogenase OS=Lolium perenne PE=2 SV=1 22 180 3.0E-09
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1 180 3.0E-09
sp|P41637|CADH_PINTA Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 26 180 4.0E-09
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 1 180 6.0E-09
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 1 180 7.0E-09
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 24 180 9.0E-09
sp|P27250|AHR_ECOLI Aldehyde reductase Ahr OS=Escherichia coli (strain K12) GN=ahr PE=1 SV=2 31 180 2.0E-08
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 1 182 3.0E-08
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 1 182 3.0E-08
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 1 180 4.0E-08
sp|P08843|ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 1 182 5.0E-08
sp|Q0JA75|CADH7_ORYSJ Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CAD7 PE=2 SV=1 1 182 5.0E-08
sp|P42754|MTDH_PETCR Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 1 182 6.0E-08
sp|P07754|ADH3_EMENI Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 1 182 8.0E-08
sp|Q6ZHS4|CADH2_ORYSJ Cinnamyl alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CAD2 PE=1 SV=1 22 182 1.0E-07
sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 25 182 2.0E-07
sp|Q7XWU3|CADH6_ORYSJ Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 22 182 2.0E-07
sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 22 182 2.0E-07
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 1 180 3.0E-07
sp|P9WQB9|ADHD_MYCTU Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 6 173 4.0E-07
sp|P9WQB8|ADHD_MYCTO Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 6 173 4.0E-07
sp|Q38707|MTDH_APIGR Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 7 182 5.0E-07
sp|O24562|CADH_MAIZE Probable cinnamyl alcohol dehydrogenase OS=Zea mays GN=CAD PE=2 SV=1 22 182 6.0E-07
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 1 180 6.0E-07
sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 22 182 7.0E-07
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 6 75 9.0E-07
sp|P93257|MTDH_MESCR Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1 7 182 1.0E-06
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 1 183 1.0E-06
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 1 183 1.0E-06
sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 22 182 1.0E-06
sp|P9WQC7|ADHB_MYCTU Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 1 173 2.0E-06
sp|P9WQC6|ADHB_MYCTO Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 1 173 2.0E-06
sp|Q7U1B9|ADHB_MYCBO Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 1 173 2.0E-06
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 2 183 3.0E-06
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 1 182 4.0E-06
sp|H1ZV38|GEOA_CASDE Geraniol dehydrogenase OS=Castellaniella defragrans GN=geoA PE=1 SV=1 5 128 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5656
MRQQGVRPGETVAIQGIGGLGHLGIQYARKMGYRVVAISSGGAKRELALQLGAHHYIDSSATSVTEEVRKLGGAK
MIVITAPDPNLMGQYTACLAWQGKLVILARNTTACGELTLSSNDLVLMSSSVSGWHAGGALDCEEAIEFARLHDV
RCMTESFPLERIQEAADRLRSSKARFRVVLTMQ*
Coding >Hirsu2|5656
ATGCGGCAGCAGGGCGTGCGGCCCGGCGAGACGGTCGCGATCCAGGGCATCGGCGGGCTGGGCCACCTCGGGATC
CAGTACGCGCGCAAGATGGGCTACCGCGTCGTCGCCATCTCCAGCGGCGGTGCGAAGCGCGAGCTGGCGCTGCAG
CTCGGCGCGCACCACTACATCGACTCGAGCGCGACGAGCGTCACCGAAGAGGTCCGCAAGCTGGGCGGCGCCAAG
ATGATCGTCATCACCGCCCCGGACCCCAACCTGATGGGGCAGTACACGGCCTGCCTCGCATGGCAGGGCAAGCTC
GTCATCTTGGCTCGCAACACAACAGCTTGTGGAGAGCTCACCCTGAGCTCCAACGACCTCGTCCTCATGTCCTCT
TCCGTCTCGGGCTGGCACGCCGGCGGCGCCCTGGACTGCGAGGAAGCCATCGAGTTCGCCCGCCTGCACGATGTC
CGATGCATGACCGAGAGCTTCCCGCTGGAACGGATCCAGGAGGCGGCCGACCGCCTCCGGAGCTCCAAAGCCCGC
TTTCGCGTCGTACTGACGATGCAGTGA
Transcript >Hirsu2|5656
ATGCGGCAGCAGGGCGTGCGGCCCGGCGAGACGGTCGCGATCCAGGGCATCGGCGGGCTGGGCCACCTCGGGATC
CAGTACGCGCGCAAGATGGGCTACCGCGTCGTCGCCATCTCCAGCGGCGGTGCGAAGCGCGAGCTGGCGCTGCAG
CTCGGCGCGCACCACTACATCGACTCGAGCGCGACGAGCGTCACCGAAGAGGTCCGCAAGCTGGGCGGCGCCAAG
ATGATCGTCATCACCGCCCCGGACCCCAACCTGATGGGGCAGTACACGGCCTGCCTCGCATGGCAGGGCAAGCTC
GTCATCTTGGCTCGCAACACAACAGCTTGTGGAGAGCTCACCCTGAGCTCCAACGACCTCGTCCTCATGTCCTCT
TCCGTCTCGGGCTGGCACGCCGGCGGCGCCCTGGACTGCGAGGAAGCCATCGAGTTCGCCCGCCTGCACGATGTC
CGATGCATGACCGAGAGCTTCCCGCTGGAACGGATCCAGGAGGCGGCCGACCGCCTCCGGAGCTCCAAAGCCCGC
TTTCGCGTCGTACTGACGATGCAGTGA
Gene >Hirsu2|5656
ATGCGGCAGCAGGGCGTGCGGCCCGGCGAGACGGTCGCGATCCAGGGCATCGGCGGGCTGGGCCACCTCGGGATC
CAGTACGCGCGCAAGATGGGCTACCGCGTCGTCGCCATCTCCAGCGGCGGTGCGAAGCGCGAGCTGGCGCTGCAG
CTCGGCGCGCACCACTACATCGACTCGAGCGCGACGAGCGTCACCGAAGAGGTCCGCAAGCTGGGCGGCGCCAAG
ATGATCGTCATCACCGCCCCGGACCCCAACCTGATGGGGCAGTACACGGCCTGCCTCGCATGGCAGGGCAAGCTC
GTCATCTTGGCTCGCAAGTTTTCCCCTCCCCTGGGCTTTCCTTTCGCTGCTGAGCTGACGAGTCACAACGGCGGA
CGCGTCTGGTCGGGGAGGGAGCACAACAGCTTGTGGAGAGCTCACCCTGAGCTCCAACGACCTCGTCCTCATGTC
CTCTTCCGTCTCGGGCTGGCACGCCGGCGGCGCCCTGGACTGCGAGGAAGCCATCGAGTTCGCCCGCCTGCACGA
TGTCCGATGCATGACCGAGAGCTTCCCGCTGGAACGGATCCAGGAGGCGGCCGACCGCCTCCGGAGCTCCAAAGC
CCGCTTTCGCGTCGTACTGACGATGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail