Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5654
Gene name
LocationContig_284:12164..13064
Strand-
Gene length (bp)900
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01596 Methyltransf_3 O-methyltransferase 4.9E-28 53 244
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 8.6E-12 60 160
PF13578 Methyltransf_24 Methyltransferase domain 1.7E-10 76 187
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-07 75 179
PF13847 Methyltransf_31 Methyltransferase domain 6.7E-07 72 188
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-04 76 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00719|MDMC_STRMY O-methyltransferase MdmC OS=Streptomyces mycarofaciens GN=mdmC PE=3 SV=1 58 244 2.0E-23
sp|Q86IC9|CAMT1_DICDI Probable caffeoyl-CoA O-methyltransferase 1 OS=Dictyostelium discoideum GN=omt5 PE=3 SV=1 2 247 7.0E-23
sp|Q86IC8|CAMT2_DICDI Probable caffeoyl-CoA O-methyltransferase 2 OS=Dictyostelium discoideum GN=omt6 PE=1 SV=1 2 247 3.0E-22
sp|Q55AS5|CAMT3_DICDI Probable caffeoyl-CoA O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt1 PE=2 SV=1 14 243 5.0E-22
sp|Q40313|CAMT_MEDSA Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1 44 244 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00719|MDMC_STRMY O-methyltransferase MdmC OS=Streptomyces mycarofaciens GN=mdmC PE=3 SV=1 58 244 2.0E-23
sp|Q86IC9|CAMT1_DICDI Probable caffeoyl-CoA O-methyltransferase 1 OS=Dictyostelium discoideum GN=omt5 PE=3 SV=1 2 247 7.0E-23
sp|Q86IC8|CAMT2_DICDI Probable caffeoyl-CoA O-methyltransferase 2 OS=Dictyostelium discoideum GN=omt6 PE=1 SV=1 2 247 3.0E-22
sp|Q55AS5|CAMT3_DICDI Probable caffeoyl-CoA O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt1 PE=2 SV=1 14 243 5.0E-22
sp|Q40313|CAMT_MEDSA Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1 44 244 3.0E-15
sp|Q9XGD5|CAMT2_MAIZE Caffeoyl-CoA O-methyltransferase 2 OS=Zea mays GN=CCOAOMT2 PE=2 SV=1 44 244 7.0E-15
sp|O49499|CAMT4_ARATH Caffeoyl-CoA O-methyltransferase 1 OS=Arabidopsis thaliana GN=CCOAOMT1 PE=1 SV=1 44 244 1.0E-14
sp|Q9XGP7|OMT15_ORYSJ Tricin synthase 1 OS=Oryza sativa subsp. japonica GN=ROMT-15 PE=1 SV=1 6 246 2.0E-14
sp|Q43095|CAMT_POPTM Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1 44 244 7.0E-14
sp|Q9SWB8|CAMT2_EUCGL Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1 44 244 1.0E-13
sp|Q43237|CAMT_VITVI Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1 44 246 1.0E-13
sp|P28034|CAMT_PETCR Caffeoyl-CoA O-methyltransferase OS=Petroselinum crispum PE=1 SV=1 44 244 1.0E-13
sp|O04899|CAMT5_TOBAC Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1 44 244 2.0E-13
sp|Q43161|CAMT_STELP Caffeoyl-CoA O-methyltransferase OS=Stellaria longipes PE=2 SV=1 30 244 2.0E-13
sp|O65862|CAMT1_POPTR Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1 44 244 2.0E-13
sp|Q42945|CAMT6_TOBAC Caffeoyl-CoA O-methyltransferase 6 OS=Nicotiana tabacum GN=CCOAOMT6 PE=2 SV=1 44 244 3.0E-13
sp|O81185|CAMT1_EUCGL Caffeoyl-CoA O-methyltransferase 1 OS=Eucalyptus globulus GN=CCOMT PE=2 SV=1 44 244 4.0E-13
sp|O04854|CAMT_EUCGU Caffeoyl-CoA O-methyltransferase OS=Eucalyptus gunnii PE=2 SV=1 44 244 4.0E-13
sp|Q9C9W4|TSM1_ARATH Tapetum-specific methyltransferase 1 OS=Arabidopsis thaliana GN=TSM1 PE=1 SV=2 59 246 7.0E-13
sp|O65922|CAMT2_POPTR Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1 44 244 8.0E-13
sp|Q41720|CAMT_ZINVI Caffeoyl-CoA O-methyltransferase OS=Zinnia violacea GN=CCOAOMT PE=2 SV=1 44 244 1.0E-12
sp|A0QCH0|Y1364_MYCA1 Putative O-methyltransferase MAV_1364 OS=Mycobacterium avium (strain 104) GN=MAV_1364 PE=3 SV=1 62 240 9.0E-12
sp|Q8H9B6|CAMT_SOLTU Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1 44 244 1.0E-11
sp|A4T8W9|Y2199_MYCGI Putative O-methyltransferase Mflv_2199 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_2199 PE=3 SV=2 62 240 1.0E-11
sp|O65162|CAMT_MESCR Caffeoyl-CoA O-methyltransferase OS=Mesembryanthemum crystallinum PE=2 SV=1 44 244 2.0E-11
sp|B2HS47|Y4217_MYCMM Putative O-methyltransferase MMAR_4217 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_4217 PE=3 SV=1 62 240 2.0E-11
sp|Q9ZTT5|CAMT_PINTA Caffeoyl-CoA O-methyltransferase OS=Pinus taeda GN=CCOAOMT PE=2 SV=1 44 244 2.0E-11
sp|Q73WV2|Y2558_MYCPA Putative O-methyltransferase MAP_2558 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_2558 PE=3 SV=2 62 240 3.0E-11
sp|Q8BIG7|CMTD1_MOUSE Catechol O-methyltransferase domain-containing protein 1 OS=Mus musculus GN=Comtd1 PE=1 SV=1 41 242 3.0E-11
sp|Q9C5D7|CAMT3_ARATH Probable caffeoyl-CoA O-methyltransferase At4g26220 OS=Arabidopsis thaliana GN=At4g26220 PE=2 SV=1 44 246 3.0E-11
sp|Q7F8T6|OMT17_ORYSJ Tricin synthase 2 OS=Oryza sativa subsp. japonica GN=ROMT-17 PE=1 SV=1 44 246 4.0E-11
sp|A0R2D5|Y5073_MYCS2 Putative O-methyltransferase MSMEG_5073/MSMEI_4947 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5073 PE=1 SV=1 62 240 5.0E-11
sp|A3Q3Q7|Y4009_MYCSJ Putative O-methyltransferase Mjls_4009 OS=Mycobacterium sp. (strain JLS) GN=Mjls_4009 PE=3 SV=2 62 240 6.0E-11
sp|Q9C9W3|CAMT1_ARATH Putative caffeoyl-CoA O-methyltransferase At1g67980 OS=Arabidopsis thaliana GN=At1g67980 PE=2 SV=1 59 246 7.0E-11
sp|Q7U0D0|Y1252_MYCBO Putative O-methyltransferase Mb1252c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1252c PE=3 SV=2 62 240 9.0E-11
sp|A1KI08|Y1280_MYCBP Putative O-methyltransferase BCG_1280c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1280c PE=3 SV=2 62 240 9.0E-11
sp|P9WJZ6|Y1220_MYCTO Putative O-methyltransferase MT1258 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1258 PE=3 SV=2 62 240 9.0E-11
sp|P9WJZ7|Y1220_MYCTU Putative O-methyltransferase Rv1220c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1220c PE=1 SV=2 62 240 9.0E-11
sp|A5U1R8|Y1229_MYCTA Putative O-methyltransferase MRA_1229 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1229 PE=3 SV=2 62 240 9.0E-11
sp|P93711|CAMT_POPKI Caffeoyl-CoA O-methyltransferase OS=Populus kitakamiensis PE=2 SV=1 59 246 1.0E-10
sp|C7AE94|FAOMT_VITVI Flavonoid 3',5'-methyltransferase OS=Vitis vinifera GN=FAOMT PE=1 SV=1 64 246 1.0E-10
sp|A1TDM2|Y4497_MYCVP Putative O-methyltransferase Mvan_4497 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_4497 PE=3 SV=2 62 240 2.0E-10
sp|O24151|CAMT4_TOBAC Caffeoyl-CoA O-methyltransferase 4 OS=Nicotiana tabacum GN=CCOAOMT4 PE=2 SV=1 44 244 2.0E-10
sp|O24144|CAMT1_TOBAC Caffeoyl-CoA O-methyltransferase 1 OS=Nicotiana tabacum GN=CCOAOMT1 PE=1 SV=1 44 244 2.0E-10
sp|O24150|CAMT3_TOBAC Caffeoyl-CoA O-methyltransferase 3 OS=Nicotiana tabacum GN=CCOAOMT3 PE=2 SV=2 44 244 3.0E-10
sp|A1UKA3|Y4069_MYCSK Putative O-methyltransferase Mkms_4069 OS=Mycobacterium sp. (strain KMS) GN=Mkms_4069 PE=3 SV=2 62 240 3.0E-10
sp|Q1B4T4|Y3995_MYCSS Putative O-methyltransferase Mmcs_3995 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_3995 PE=3 SV=2 62 240 3.0E-10
sp|A0PVW4|Y4520_MYCUA Putative O-methyltransferase MUL_4520 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_4520 PE=3 SV=1 62 240 6.0E-10
sp|Q9SLP8|CAMT_CITNA Caffeoyl-CoA O-methyltransferase OS=Citrus natsudaidai PE=3 SV=1 44 244 9.0E-10
sp|O24149|CAMT2_TOBAC Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana tabacum GN=CCOAOMT2 PE=2 SV=1 44 244 2.0E-09
sp|A8AAV7|PIMT_IGNH4 Protein-L-isoaspartate O-methyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pcm PE=3 SV=1 74 163 4.0E-09
sp|Q86VU5|CMTD1_HUMAN Catechol O-methyltransferase domain-containing protein 1 OS=Homo sapiens GN=COMTD1 PE=1 SV=1 41 242 4.0E-09
sp|Q9CCA7|Y1075_MYCLE Putative O-methyltransferase ML1075 OS=Mycobacterium leprae (strain TN) GN=ML1075 PE=3 SV=1 62 240 6.0E-09
sp|B8ZQZ1|Y1075_MYCLB Putative O-methyltransferase MLBr01075 OS=Mycobacterium leprae (strain Br4923) GN=MLBr01075 PE=3 SV=1 62 240 6.0E-09
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 64 195 8.0E-09
sp|O32036|YRRM_BACSU Putative O-methyltransferase YrrM OS=Bacillus subtilis (strain 168) GN=yrrM PE=3 SV=1 73 244 1.0E-08
sp|Q9XGD6|CAMT1_MAIZE Caffeoyl-CoA O-methyltransferase 1 OS=Zea mays GN=CCOAOMT1 PE=2 SV=1 44 244 2.0E-08
sp|O30199|PIMT1_ARCFU Protein-L-isoaspartate O-methyltransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm1 PE=3 SV=1 72 202 2.0E-08
sp|Q8NKC1|COMT2_SCHPO Probable catechol O-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB21E7.04c PE=3 SV=1 52 191 5.0E-08
sp|A0B9U1|PIMT_METTP Protein-L-isoaspartate O-methyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pcm PE=3 SV=1 74 170 7.0E-08
sp|B1MLM0|Y1361_MYCA9 Putative O-methyltransferase MAB_1361c OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=MAB_1361c PE=3 SV=1 62 240 2.0E-07
sp|O27962|PIMT2_ARCFU Protein-L-isoaspartate O-methyltransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm2 PE=3 SV=1 74 168 7.0E-07
sp|A7HL14|PIMT_FERNB Protein-L-isoaspartate O-methyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pcm PE=3 SV=1 74 149 1.0E-06
sp|Q8TYL4|PIMT_METKA Protein-L-isoaspartate O-methyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pcm PE=3 SV=1 54 170 1.0E-06
sp|Q12UV0|PIMT_METBU Protein-L-isoaspartate O-methyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pcm PE=3 SV=1 54 167 1.0E-06
sp|Q57636|PIMT_METJA Protein-L-isoaspartate O-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pcm PE=1 SV=1 33 151 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008171 O-methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5654
MTAARDADCKVLFASASLADKVCRYAESHSTPLPRHIAAYHAAVSSRRPDAFMLSVGHQAQLYAFLARALGAKRV
LEIGSYVGYSAMVWAHAVGPHGFVTGLELCPAMADEARRELCANDVSNVDIVVGDAAHTLAELPADQPYDLVLID
ADKIGYPAYLRQMLARSRPGEAKRLLRPGCVIVVDNVLRWGHVADASLDTNYWSSGEAKERELDALGRLNDMCVS
DPRLEVCMLPLWDGVSLVRLLD*
Coding >Hirsu2|5654
ATGACCGCCGCCCGGGACGCCGACTGCAAGGTCCTCTTCGCCTCGGCCTCGCTCGCCGACAAGGTCTGCCGCTAC
GCCGAGAGCCACTCGACGCCGCTGCCGCGCCACATCGCCGCCTACCACGCGGCCGTGTCGTCGCGCCGGCCGGAC
GCGTTCATGCTGAGCGTCGGCCACCAGGCGCAGCTGTACGCCTTCCTGGCCCGGGCCCTGGGCGCGAAACGCGTT
CTCGAAATCGGCTCCTACGTCGGATACTCGGCCATGGTCTGGGCCCACGCCGTCGGGCCGCACGGCTTCGTCACC
GGCCTCGAGCTCTGTCCCGCCATGGCGGACGAGGCGAGGCGGGAGCTGTGCGCCAACGACGTGTCCAACGTCGAC
ATCGTCGTCGGCGACGCCGCGCACACGCTGGCGGAACTGCCGGCGGACCAGCCGTACGACCTCGTCCTCATCGAC
GCCGACAAGATCGGCTACCCGGCCTACCTGAGGCAGATGCTTGCGCGGTCCCGGCCCGGCGAGGCGAAGCGCCTG
CTGCGCCCCGGGTGCGTCATCGTCGTGGACAACGTGCTGCGCTGGGGCCACGTGGCGGATGCCTCGCTCGACACC
AACTACTGGTCGTCCGGCGAGGCCAAGGAGCGGGAGCTGGACGCCTTGGGCCGGCTCAACGACATGTGCGTGTCG
GATCCGCGGCTCGAGGTCTGCATGCTGCCGCTCTGGGACGGCGTGAGCCTGGTCCGGCTGCTGGATTAG
Transcript >Hirsu2|5654
ATGACCGCCGCCCGGGACGCCGACTGCAAGGTCCTCTTCGCCTCGGCCTCGCTCGCCGACAAGGTCTGCCGCTAC
GCCGAGAGCCACTCGACGCCGCTGCCGCGCCACATCGCCGCCTACCACGCGGCCGTGTCGTCGCGCCGGCCGGAC
GCGTTCATGCTGAGCGTCGGCCACCAGGCGCAGCTGTACGCCTTCCTGGCCCGGGCCCTGGGCGCGAAACGCGTT
CTCGAAATCGGCTCCTACGTCGGATACTCGGCCATGGTCTGGGCCCACGCCGTCGGGCCGCACGGCTTCGTCACC
GGCCTCGAGCTCTGTCCCGCCATGGCGGACGAGGCGAGGCGGGAGCTGTGCGCCAACGACGTGTCCAACGTCGAC
ATCGTCGTCGGCGACGCCGCGCACACGCTGGCGGAACTGCCGGCGGACCAGCCGTACGACCTCGTCCTCATCGAC
GCCGACAAGATCGGCTACCCGGCCTACCTGAGGCAGATGCTTGCGCGGTCCCGGCCCGGCGAGGCGAAGCGCCTG
CTGCGCCCCGGGTGCGTCATCGTCGTGGACAACGTGCTGCGCTGGGGCCACGTGGCGGATGCCTCGCTCGACACC
AACTACTGGTCGTCCGGCGAGGCCAAGGAGCGGGAGCTGGACGCCTTGGGCCGGCTCAACGACATGTGCGTGTCG
GATCCGCGGCTCGAGGTCTGCATGCTGCCGCTCTGGGACGGCGTGAGCCTGGTCCGGCTGCTGGATTAG
Gene >Hirsu2|5654
ATGACCGCCGCCCGGGACGCCGACTGCAAGGTCCTCTTCGCCTCGGCCTCGCTCGCCGACAAGGTCTGCCGCTAC
GCCGAGAGCCACTCGACGCCGCTGCCGCGCCACATCGCCGCCTACCACGCGGCCGTGTCGTCGCGCCGGCCGGAC
GCGTTCATGCTGAGCGTCGGCCACCAGGCGCAGCTGTACGCCTTCCTGGCCCGGGCCCTGGGCGCGAAACGCGGT
CGGTGGCCCTCCCCCCATCCATCCTTTGTCTTGTCTCCCTCTCTCGGGGCTCGATGCTGAATGTGTTGACGCCCG
CGTCGTGGCAGTTCTCGAAATCGGCTCCTACGTCGGATACTCGGCCATGGTCTGGGCCCACGCCGTCGGGCCGCA
CGGCTTCGTCACCGGCCTCGAGCTCTGTCCCGCCATGGCGGACGAGGCGAGGCGGGAGCTGTGCGCCAACGACGT
GTCCAACGTCGACATCGTCGTCGGCGACGCCGCGCACACGTGAGCCTCCTCCGGCCCAGAAACCCCCCCTTCCGT
CTCTATGCAGAAGCGCTGAGAAGAAGTCCAAGGCTGGCGGAACTGCCGGCGGACCAGCCGTACGACCTCGTCCTC
ATCGACGCCGACAAGATCGGCTACCCGGCCTACCTGAGGCAGATGCTTGCGCGGTCCCGGCCCGGCGAGGCGAAG
CGCCTGCTGCGCCCCGGGTGCGTCATCGTCGTGGACAACGTGCTGCGCTGGGGCCACGTGGCGGATGCCTCGCTC
GACACCAACTACTGGTCGTCCGGCGAGGCCAAGGAGCGGGAGCTGGACGCCTTGGGCCGGCTCAACGACATGTGC
GTGTCGGATCCGCGGCTCGAGGTCTGCATGCTGCCGCTCTGGGACGGCGTGAGCCTGGTCCGGCTGCTGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail