Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|565
Gene name
LocationContig_111:27620..29708
Strand+
Gene length (bp)2088
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 1.1E-38 18 468

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 3 532 6.0E-83
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 3 532 5.0E-82
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 3 467 9.0E-82
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 472 5.0E-79
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 3 486 2.0E-57

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022804 active transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015297 antiporter activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 34 53 19
3 73 95 22
4 107 129 22
5 246 268 22
6 342 359 17
7 369 387 18
8 407 424 17
9 451 473 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|565
MPSLDVSELNIVLSVLGTFIILYGIISVKIKQKWYLGEALPAVVIGIILGPIAAKFLDSERWGSGERGQTPEITS
GVARVMIGVQLVIAGYQLPAKYNLIRWKEMTMCLLPIMTIMWLCTTLCMLATVPKVTLLAALVIGSCVTCTDPIL
SQAIAKGPFADKFVARPLREIISSEAGANDGFGFPFLFLAVYLIRHADVPGAGGTEEKRSVVAAAVDGAARLLSA
RAEEEVGRLGGGVGVALRNWFLETWLYIVLLSVVYGAVVGYGADKAVKLALRRKWIDGESYVLFPTALGLFLVGT
CGAIGTDDLLACFVAGNALNWDGEYLAETERRHDEVNSCVDVLLNFGGFMFIGTVMPWSEFNDPDGTGITYGRLV
LLGFMVLLFRRIPAILLSYKLMPAVVRDWKEALFMGYFGPIGAGAVFYVEHTRHLFPEPGRGDAEETNLVRAMVP
VVYWLVLFSIVVHGLSIPGLNLIYKYMGVKPIQEDSVEIRRLSTRAATPPNAVTGSRDTFIAYNRFSRPVFDPDG
LPVSRARSESRDGRSRSRNRSGSRHDDDDAFASANHNHNGFPEDFKFPPAPPGPQYSAFPGLPADVEPFEKPRTI
RYQS*
Coding >Hirsu2|565
ATGCCGAGCCTCGATGTGTCTGAGCTCAACATTGTTCTCTCGGTGTTGGGCACCTTCATCATCCTGTATGGCATC
ATCTCCGTCAAGATCAAGCAGAAATGGTATCTGGGCGAAGCCTTGCCCGCCGTCGTCATCGGCATCATCCTCGGC
CCCATAGCCGCCAAGTTCCTCGACAGCGAGCGATGGGGGTCGGGCGAGAGGGGGCAGACGCCTGAGATTACGTCG
GGCGTCGCGCGCGTCATGATCGGCGTCCAGCTCGTCATCGCCGGATACCAGCTGCCGGCCAAGTATAACCTGATC
CGGTGGAAGGAGATGACGATGTGTCTGCTGCCGATCATGACCATCATGTGGCTGTGCACGACGCTGTGCATGCTG
GCGACGGTGCCCAAGGTGACGCTGCTGGCGGCGCTGGTCATCGGCTCGTGCGTCACCTGCACGGATCCGATCCTG
TCGCAGGCCATCGCCAAGGGGCCCTTCGCCGACAAGTTCGTGGCGCGGCCGCTGCGGGAGATCATCTCGTCCGAG
GCCGGCGCCAACGACGGCTTCGGCTTCCCCTTCCTCTTCCTGGCCGTCTACCTGATCCGGCACGCCGACGTGCCC
GGCGCCGGCGGGACCGAGGAAAAGCGGTCGGTGGTGGCGGCGGCCGTGGACGGCGCGGCCCGGCTGCTGTCGGCG
CGGGCCGAGGAGGAGGTGGGCCGGCTCGGGGGCGGCGTCGGCGTCGCGCTGCGCAACTGGTTCCTCGAGACGTGG
CTGTACATCGTGCTCCTGTCCGTCGTCTACGGCGCCGTCGTCGGCTACGGCGCCGACAAGGCCGTCAAGCTGGCG
CTGCGCCGCAAGTGGATCGACGGCGAGTCGTACGTGCTCTTCCCGACGGCGCTCGGCCTCTTCCTCGTCGGCACC
TGCGGCGCCATCGGCACCGACGACCTGCTGGCCTGCTTCGTCGCCGGCAACGCCCTCAACTGGGACGGCGAGTAC
CTGGCCGAGACGGAGCGGCGGCACGACGAGGTCAACTCGTGCGTCGACGTCCTGCTCAACTTCGGCGGCTTCATG
TTCATCGGCACCGTCATGCCCTGGTCCGAGTTCAACGACCCGGACGGCACCGGCATCACCTACGGCCGCCTCGTC
CTGCTCGGCTTCATGGTCCTGCTCTTCCGCCGCATCCCGGCCATCCTGCTCTCCTACAAGCTGATGCCGGCCGTC
GTCCGCGACTGGAAGGAGGCCCTGTTCATGGGCTACTTCGGCCCCATCGGCGCCGGCGCCGTCTTCTACGTCGAG
CACACCCGCCACCTCTTCCCCGAGCCGGGCCGCGGCGACGCCGAGGAGACCAACCTGGTGCGCGCCATGGTCCCC
GTCGTCTACTGGCTCGTCCTCTTCTCCATCGTCGTCCACGGCCTGTCCATCCCGGGCCTCAACCTCATCTACAAG
TACATGGGCGTCAAGCCGATCCAGGAGGACTCGGTCGAGATCCGCCGCCTGTCCACCCGCGCCGCCACGCCGCCC
AACGCCGTCACCGGCAGCCGCGACACCTTCATCGCCTACAACCGCTTCAGCCGGCCCGTCTTCGACCCGGACGGC
CTGCCCGTCTCCCGCGCCCGCTCCGAGTCGCGCGACGGCCGCTCCCGCTCCCGGAACCGCTCCGGCTCGCGCCAC
GACGACGACGACGCCTTCGCCTCCGCCAACCACAACCACAACGGCTTCCCCGAAGACTTCAAGTTCCCGCCCGCC
CCCCCCGGGCCCCAGTACAGCGCCTTCCCGGGCCTGCCCGCCGACGTCGAGCCGTTCGAGAAGCCGAGGACGATC
CGGTACCAGAGTTAG
Transcript >Hirsu2|565
ATGCCGAGCCTCGATGTGTCTGAGCTCAACATTGTTCTCTCGGTGTTGGGCACCTTCATCATCCTGTATGGCATC
ATCTCCGTCAAGATCAAGCAGAAATGGTATCTGGGCGAAGCCTTGCCCGCCGTCGTCATCGGCATCATCCTCGGC
CCCATAGCCGCCAAGTTCCTCGACAGCGAGCGATGGGGGTCGGGCGAGAGGGGGCAGACGCCTGAGATTACGTCG
GGCGTCGCGCGCGTCATGATCGGCGTCCAGCTCGTCATCGCCGGATACCAGCTGCCGGCCAAGTATAACCTGATC
CGGTGGAAGGAGATGACGATGTGTCTGCTGCCGATCATGACCATCATGTGGCTGTGCACGACGCTGTGCATGCTG
GCGACGGTGCCCAAGGTGACGCTGCTGGCGGCGCTGGTCATCGGCTCGTGCGTCACCTGCACGGATCCGATCCTG
TCGCAGGCCATCGCCAAGGGGCCCTTCGCCGACAAGTTCGTGGCGCGGCCGCTGCGGGAGATCATCTCGTCCGAG
GCCGGCGCCAACGACGGCTTCGGCTTCCCCTTCCTCTTCCTGGCCGTCTACCTGATCCGGCACGCCGACGTGCCC
GGCGCCGGCGGGACCGAGGAAAAGCGGTCGGTGGTGGCGGCGGCCGTGGACGGCGCGGCCCGGCTGCTGTCGGCG
CGGGCCGAGGAGGAGGTGGGCCGGCTCGGGGGCGGCGTCGGCGTCGCGCTGCGCAACTGGTTCCTCGAGACGTGG
CTGTACATCGTGCTCCTGTCCGTCGTCTACGGCGCCGTCGTCGGCTACGGCGCCGACAAGGCCGTCAAGCTGGCG
CTGCGCCGCAAGTGGATCGACGGCGAGTCGTACGTGCTCTTCCCGACGGCGCTCGGCCTCTTCCTCGTCGGCACC
TGCGGCGCCATCGGCACCGACGACCTGCTGGCCTGCTTCGTCGCCGGCAACGCCCTCAACTGGGACGGCGAGTAC
CTGGCCGAGACGGAGCGGCGGCACGACGAGGTCAACTCGTGCGTCGACGTCCTGCTCAACTTCGGCGGCTTCATG
TTCATCGGCACCGTCATGCCCTGGTCCGAGTTCAACGACCCGGACGGCACCGGCATCACCTACGGCCGCCTCGTC
CTGCTCGGCTTCATGGTCCTGCTCTTCCGCCGCATCCCGGCCATCCTGCTCTCCTACAAGCTGATGCCGGCCGTC
GTCCGCGACTGGAAGGAGGCCCTGTTCATGGGCTACTTCGGCCCCATCGGCGCCGGCGCCGTCTTCTACGTCGAG
CACACCCGCCACCTCTTCCCCGAGCCGGGCCGCGGCGACGCCGAGGAGACCAACCTGGTGCGCGCCATGGTCCCC
GTCGTCTACTGGCTCGTCCTCTTCTCCATCGTCGTCCACGGCCTGTCCATCCCGGGCCTCAACCTCATCTACAAG
TACATGGGCGTCAAGCCGATCCAGGAGGACTCGGTCGAGATCCGCCGCCTGTCCACCCGCGCCGCCACGCCGCCC
AACGCCGTCACCGGCAGCCGCGACACCTTCATCGCCTACAACCGCTTCAGCCGGCCCGTCTTCGACCCGGACGGC
CTGCCCGTCTCCCGCGCCCGCTCCGAGTCGCGCGACGGCCGCTCCCGCTCCCGGAACCGCTCCGGCTCGCGCCAC
GACGACGACGACGCCTTCGCCTCCGCCAACCACAACCACAACGGCTTCCCCGAAGACTTCAAGTTCCCGCCCGCC
CCCCCCGGGCCCCAGTACAGCGCCTTCCCGGGCCTGCCCGCCGACGTCGAGCCGTTCGAGAAGCCGAGGACGATC
CGGTACCAGAGTTAG
Gene >Hirsu2|565
ATGCCGAGCCTCGATGTGTCTGAGCTCAACATTGTTCTCTCGGTGTTGGGTGAGAAAAACCGGACCTGTGTCGTG
TTGGCGGCCGAGCTGACCGGTTTGTGCTGCCCAGGCACCTTCATCATCCTGTATGGCATCATCTCCGTCAAGATC
AAGCAGAAATGGTATCTGGGCGAAGCCTGTGAGTCTGCCGAGTCGGGAGCGGACAGCGGCCGAGTTGCGCGGATG
GGTTTTGACTTATATATATATATGAACGGCAGTGCCCGCCGTCGTCATCGGCATCATCCTCGGCCCCATAGCCGC
CAAGTTCCTCGACAGCGAGCGATGGGGGTCGGGCGAGAGGGGGCAGACGCCTGAGATTACGTCGGTAAGAGGCTT
CTTCTTTTTCTTCTTCGTCTTCTTCATCTTCTTCTTCGCCTCCTTTCTTCCCACCCTCGGCCTCCTTCCGGTGCA
GAGTCCAGGTTCGGCTGACAGGTTGTCGTCGTCGTTCGTCTGGGCCAGGGCGTCGCGCGCGTCATGATCGGCGTC
CAGCTCGTCATCGCCGGATACCAGCTGCCGGCCAAGTATAACCTGATCCGGTGGAAGGAGATGACGATGTGTCTG
CTGCCGATCATGACCATCATGTGGCTGTGCACGACGCTGTGCATGCTGGCGACGGTGCCCAAGGTGACGCTGCTG
GCGGCGCTGGTCATCGGCTCGTGCGTCACCTGCACGGATCCGATCCTGTCGCAGGCCATCGCCAAGGGGCCCTTC
GCCGACAAGTTCGTGGCGCGGCCGCTGCGGGAGATCATCTCGTCCGAGGCCGGCGCCAACGACGGCTTCGGCTTC
CCCTTCCTCTTCCTGGCCGTCTACCTGATCCGGCACGCCGACGTGCCCGGCGCCGGCGGGACCGAGGAAAAGCGG
TCGGTGGTGGCGGCGGCCGTGGACGGCGCGGCCCGGCTGCTGTCGGCGCGGGCCGAGGAGGAGGTGGGCCGGCTC
GGGGGCGGCGTCGGCGTCGCGCTGCGCAACTGGTTCCTCGAGACGTGGCTGTACATCGTGCTCCTGTCCGTCGTC
TACGGCGCCGTCGTCGGCTACGGCGCCGACAAGGCCGTCAAGCTGGCGCTGCGCCGCAAGTGGATCGACGGCGAG
TCGTACGTGCTCTTCCCGACGGCGCTCGGCCTCTTCCTCGTCGGCACCTGCGGCGCCATCGGCACCGACGACCTG
CTGGCCTGCTTCGTCGCCGGCAACGCCCTCAACTGGGACGGCGAGTACCTGGCCGAGACGGAGCGGCGGCACGAC
GAGGTCAACTCGTGCGTCGACGTCCTGCTCAACTTCGGCGGCTTCATGTTCATCGGCACCGTCATGCCCTGGTCC
GAGTTCAACGACCCGGACGGCACCGGCATCACCTACGGCCGCCTCGTCCTGCTCGGCTTCATGGTCCTGCTCTTC
CGCCGCATCCCGGCCATCCTGCTCTCCTACAAGCTGATGCCGGCCGTCGTCCGCGACTGGAAGGAGGCCCTGTTC
ATGGGCTACTTCGGCCCCATCGGCGCCGGCGCCGTCTTCTACGTCGAGCACACCCGCCACCTCTTCCCCGAGCCG
GGCCGCGGCGACGCCGAGGAGACCAACCTGGTGCGCGCCATGGTCCCCGTCGTCTACTGGCTCGTCCTCTTCTCC
ATCGTCGTCCACGGCCTGTCCATCCCGGGCCTCAACCTCATCTACAAGTACATGGGCGTCAAGCCGATCCAGGAG
GACTCGGTCGAGATCCGCCGCCTGTCCACCCGCGCCGCCACGCCGCCCAACGCCGTCACCGGCAGCCGCGACACC
TTCATCGCCTACAACCGCTTCAGCCGGCCCGTCTTCGACCCGGACGGCCTGCCCGTCTCCCGCGCCCGCTCCGAG
TCGCGCGACGGCCGCTCCCGCTCCCGGAACCGCTCCGGCTCGCGCCACGACGACGACGACGCCTTCGCCTCCGCC
AACCACAACCACAACGGCTTCCCCGAAGACTTCAAGTTCCCGCCCGCCCCCCCCGGGCCCCAGTACAGCGCCTTC
CCGGGCCTGCCCGCCGACGTCGAGCCGTTCGAGAAGCCGAGGACGATCCGGTACCAGAGTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail