Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5649
Gene name
LocationContig_2838:511..1607
Strand-
Gene length (bp)1096
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-36 2 263
PF00083 Sugar_tr Sugar (and other) transporter 5.0E-09 11 156
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 9.4E-08 46 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 159 2.0E-55
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 1 160 2.0E-40
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 179 4.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 171 6.0E-23
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 4 174 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 159 2.0E-55
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 1 160 2.0E-40
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 179 4.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 171 6.0E-23
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 4 174 1.0E-20
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 4 174 1.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 5 179 6.0E-19
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 4 251 5.0E-18
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 4 191 2.0E-17
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 1 171 2.0E-17
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 166 3.0E-17
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 4 170 7.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 1 171 8.0E-17
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 1 145 2.0E-16
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 1 162 6.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 1 258 2.0E-15
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 6 166 1.0E-14
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 1 170 2.0E-14
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 5 251 2.0E-14
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 168 3.0E-14
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 4 170 4.0E-14
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 1 156 4.0E-14
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 3 182 9.0E-14
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 1 182 1.0E-13
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 9 182 2.0E-13
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 17 171 2.0E-13
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 2 154 6.0E-13
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 2 154 6.0E-13
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 31 162 1.0E-12
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 1 164 1.0E-12
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 1 159 2.0E-12
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 1 177 3.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 3 169 4.0E-12
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 1 165 7.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 1 165 7.0E-12
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 1 156 1.0E-11
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 1 163 2.0E-11
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 1 163 2.0E-11
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 1 156 2.0E-11
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 1 172 3.0E-11
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 1 215 1.0E-10
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 1 172 2.0E-10
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 1 172 2.0E-10
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 1 172 3.0E-10
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 1 172 3.0E-10
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 1 160 4.0E-10
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 1 185 4.0E-10
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 1 172 5.0E-10
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 30 156 2.0E-09
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 1 178 2.0E-09
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 3 164 3.0E-09
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 1 160 4.0E-09
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 1 170 4.0E-09
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 1 170 4.0E-09
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 173 7.0E-09
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 1 170 7.0E-09
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 1 170 1.0E-08
sp|Q8K902|Y567_BUCAP Uncharacterized transporter BUsg_567 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_567 PE=3 SV=1 1 156 1.0E-08
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 17 170 2.0E-08
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 1 158 3.0E-08
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 1 171 3.0E-08
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 1 170 3.0E-08
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 1 162 5.0E-08
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 1 170 6.0E-08
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 153 1.0E-07
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 1 165 2.0E-07
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 1 162 3.0E-07
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 153 3.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 1 158 3.0E-07
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 6 132 4.0E-07
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 6 132 5.0E-07
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 1 158 7.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 2 161 1.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 1 156 1.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 1 156 1.0E-06
sp|Q62795|NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus GN=Slc17a1 PE=2 SV=1 62 166 1.0E-06
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 40 208 1.0E-06
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 19 160 3.0E-06
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 7 165 3.0E-06
sp|Q61983|NPT1_MOUSE Sodium-dependent phosphate transport protein 1 OS=Mus musculus GN=Slc17a1 PE=1 SV=2 62 197 4.0E-06
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 13 174 4.0E-06
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 2 162 5.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 37 148 6.0E-06
sp|O34367|YTBD_BACSU Uncharacterized MFS-type transporter YtbD OS=Bacillus subtilis (strain 168) GN=ytbD PE=3 SV=1 1 170 7.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 1 137 7.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 6 158 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1489 0.1234 0.2603 0.3538 0.2479 0.0229 0.6183 0.3038 0.1975 0.0124

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 70 92 22
4 107 126 19
5 133 152 19
6 229 251 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup575
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4853
Ophiocordyceps australis map64 (Brazil) OphauB2|5300
Ophiocordyceps camponoti-floridani Ophcf2|02062
Ophiocordyceps camponoti-floridani Ophcf2|07428
Ophiocordyceps camponoti-rufipedis Ophun1|1032
Ophiocordyceps kimflemingae Ophio5|7873
Ophiocordyceps subramaniannii Hirsu2|5648
Ophiocordyceps subramaniannii Hirsu2|5649 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5649
LPAVASEFETTATVTNLAVAMYLLSMSIFPLWWSSFSEQFGRRSIYLISFGLFAVFAAGCGASSNAAMLVVLRVL
TGGASASVQAVGAGTIADLWEPHERGRAMSTFYLGPLLGPLVAPIVGGALAQQFGWRACMYLLAVYGALILLLLF
FLLPETLPRRAKADRQQQQQPPPPPHHHHPSSFSSSSSSGDWPAPLRRATTVESARVRTRRLAAGAKRFVVDPLR
VLLFLRFPPVLITVLVAAIAFGALYVANVAIQQKFSAPPTASFGSSPPSAASFSASPP*
Coding >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCTACGGCGTCTTTTGGTTCGTCCCCTCCATCGGCG
GCTTCCTTTTCGGCCTCTCCTCCATGA
Transcript >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCTACGGCGTCTTTTGGTTCGTCCCCTCCATCGGCG
GCTTCCTTTTCGGCCTCTCCTCCATGA
Gene >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCGTACCGCTTCCGCCAGCTCGTCGTCGGCCTGCTC
TACATACCGCCGGGCCTCGGCTACTTCACCGCCTCGCTCTTCGGCGGCCGCTGGATCGACCGGATCATGGCCCGC
GAGGCCAGGCGGGCCAACCGCTACGACGACCGCGGCCGCCTCGTCTACCTGCCCGAGGACCGGATGCGCGAGAAC
ATCTGGCTGGCCAACGCCGTCTACCCGCTGGCGCTGCTGCTGCTCGGCTGGACGCTGCAGTACGGCGTCTTTTGG
TTCGTCCCCTCCATCGGCGGCTTCCTTTTCGGCCTCTCCTCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail