Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5649
Gene name
LocationContig_2838:511..1607
Strand-
Gene length (bp)1096
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-36 2 263
PF00083 Sugar_tr Sugar (and other) transporter 4.6E-09 11 156
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 9.2E-09 43 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 159 2.0E-55
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 1 160 2.0E-40
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 179 4.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 171 6.0E-23
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 4 174 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 159 2.0E-55
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 1 160 2.0E-40
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 179 4.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 171 6.0E-23
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 4 174 1.0E-20
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 4 174 1.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 5 179 6.0E-19
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 4 251 5.0E-18
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 4 191 2.0E-17
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 1 171 2.0E-17
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 166 3.0E-17
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 4 170 7.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 1 171 8.0E-17
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 1 145 2.0E-16
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 1 162 6.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 1 258 2.0E-15
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 6 166 1.0E-14
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 1 170 2.0E-14
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 5 251 2.0E-14
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 168 3.0E-14
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 4 170 4.0E-14
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 1 156 4.0E-14
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 3 182 9.0E-14
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 1 182 1.0E-13
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 9 182 2.0E-13
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 17 171 2.0E-13
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 2 154 6.0E-13
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 2 154 6.0E-13
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 31 162 1.0E-12
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 1 164 1.0E-12
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 1 159 2.0E-12
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 1 177 3.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 3 169 4.0E-12
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 1 165 7.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 1 165 7.0E-12
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 1 156 1.0E-11
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 1 163 2.0E-11
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 1 163 2.0E-11
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 1 156 2.0E-11
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 1 172 3.0E-11
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 1 215 1.0E-10
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 1 172 1.0E-10
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 1 172 2.0E-10
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 1 172 2.0E-10
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 1 172 3.0E-10
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 1 172 3.0E-10
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 1 160 4.0E-10
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 1 185 4.0E-10
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 1 172 5.0E-10
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 30 156 2.0E-09
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 1 178 2.0E-09
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 3 164 3.0E-09
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 1 160 4.0E-09
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 1 170 4.0E-09
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 1 170 4.0E-09
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 1 170 5.0E-09
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 173 7.0E-09
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 1 170 7.0E-09
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 1 170 1.0E-08
sp|Q8K902|Y567_BUCAP Uncharacterized transporter BUsg_567 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_567 PE=3 SV=1 1 156 1.0E-08
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 17 170 2.0E-08
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 1 170 2.0E-08
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 1 158 3.0E-08
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 1 171 3.0E-08
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 1 170 3.0E-08
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 1 170 3.0E-08
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 1 158 4.0E-08
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 1 162 5.0E-08
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 1 170 6.0E-08
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 153 1.0E-07
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 1 165 2.0E-07
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 1 162 3.0E-07
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 153 3.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 1 158 3.0E-07
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 6 132 4.0E-07
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 6 132 5.0E-07
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 1 158 7.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 2 161 1.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 1 156 1.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 1 156 1.0E-06
sp|Q62795|NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus GN=Slc17a1 PE=2 SV=1 62 166 1.0E-06
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 40 208 1.0E-06
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 19 160 3.0E-06
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 7 165 3.0E-06
sp|Q61983|NPT1_MOUSE Sodium-dependent phosphate transport protein 1 OS=Mus musculus GN=Slc17a1 PE=1 SV=2 62 197 4.0E-06
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 13 174 4.0E-06
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 2 162 5.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 37 148 6.0E-06
sp|O34367|YTBD_BACSU Uncharacterized MFS-type transporter YtbD OS=Bacillus subtilis (strain 168) GN=ytbD PE=3 SV=1 1 170 7.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 1 137 7.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 6 158 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 70 92 22
4 107 126 19
5 133 152 19
6 229 251 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5649
LPAVASEFETTATVTNLAVAMYLLSMSIFPLWWSSFSEQFGRRSIYLISFGLFAVFAAGCGASSNAAMLVVLRVL
TGGASASVQAVGAGTIADLWEPHERGRAMSTFYLGPLLGPLVAPIVGGALAQQFGWRACMYLLAVYGALILLLLF
FLLPETLPRRAKADRQQQQQPPPPPHHHHPSSFSSSSSSGDWPAPLRRATTVESARVRTRRLAAGAKRFVVDPLR
VLLFLRFPPVLITVLVAAIAFGALYVANVAIQQKFSAPPTASFGSSPPSAASFSASPP*
Coding >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCTACGGCGTCTTTTGGTTCGTCCCCTCCATCGGCG
GCTTCCTTTTCGGCCTCTCCTCCATGA
Transcript >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCTACGGCGTCTTTTGGTTCGTCCCCTCCATCGGCG
GCTTCCTTTTCGGCCTCTCCTCCATGA
Gene >Hirsu2|5649
CTGCCGGCGGTGGCGTCCGAGTTCGAGACGACGGCGACGGTGACGAACCTGGCGGTAGCCATGTACCTGCTGTCC
ATGTCCATCTTCCCGCTGTGGTGGTCGTCCTTCTCGGAGCAGTTTGGGCGGCGGAGCATCTACCTCATCTCGTTC
GGCCTGTTCGCCGTCTTCGCGGCCGGGTGTGGCGCCAGCAGCAACGCGGCCATGCTGGTCGTGCTGCGCGTGCTG
ACGGGTGGCGCCTCGGCCAGCGTCCAGGCCGTCGGCGCCGGCACCATCGCCGACCTGTGGGAGCCGCACGAGCGC
GGCCGCGCCATGAGCACCTTCTACCTCGGCCCGCTGCTGGGCCCGCTGGTGGCGCCCATCGTCGGTGGCGCCCTG
GCCCAGCAGTTCGGCTGGCGTGCCTGCATGTACCTGCTCGCCGTCTACGGCGCCCTCATTCTGCTGCTGCTCTTC
TTCCTGCTGCCCGAGACGCTGCCGCGGCGCGCCAAGGCGGACCGACAGCAGCAGCAGCAGCCGCCGCCGCCGCCG
CATCACCACCACCCCTCCTCCTTCTCCTCCTCCTCCTCGTCGGGCGATTGGCCGGCGCCGCTCCGCCGCGCGACG
ACGGTCGAGTCGGCCCGAGTGCGGACGCGGCGGCTGGCGGCGGGCGCCAAGCGCTTCGTCGTCGACCCGCTGCGC
GTCCTGCTCTTCCTGCGCTTCCCGCCCGTGCTCATCACGGTGCTGGTGGCGGCCATCGCCTTCGGCGCCCTCTAT
GTCGCCAACGTGGCCATCCAGCAGAAGTTCTCGGCGCCGCCGTACCGCTTCCGCCAGCTCGTCGTCGGCCTGCTC
TACATACCGCCGGGCCTCGGCTACTTCACCGCCTCGCTCTTCGGCGGCCGCTGGATCGACCGGATCATGGCCCGC
GAGGCCAGGCGGGCCAACCGCTACGACGACCGCGGCCGCCTCGTCTACCTGCCCGAGGACCGGATGCGCGAGAAC
ATCTGGCTGGCCAACGCCGTCTACCCGCTGGCGCTGCTGCTGCTCGGCTGGACGCTGCAGTACGGCGTCTTTTGG
TTCGTCCCCTCCATCGGCGGCTTCCTTTTCGGCCTCTCCTCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail