Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5646
Gene name
LocationContig_2836:70..845
Strand-
Gene length (bp)775
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16546 SGTA_dimer Homodimerisation domain of SGTA 2.3E-25 4 68
PF07719 TPR_2 Tetratricopeptide repeat 5.3E-05 104 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 1 176 3.0E-26
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 4 176 1.0E-25
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 4 176 2.0E-25
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 4 176 4.0E-24
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 4 176 7.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 1 176 3.0E-26
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 4 176 1.0E-25
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 4 176 2.0E-25
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 4 176 4.0E-24
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 4 176 7.0E-24
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 3 176 1.0E-22
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 3 176 3.0E-21
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 3 176 3.0E-21
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 4 181 8.0E-20
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 3 175 8.0E-17
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 104 176 1.0E-11
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 103 175 3.0E-11
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 103 175 5.0E-11
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 96 175 2.0E-10
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 96 175 3.0E-10
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 96 175 6.0E-10
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 104 176 2.0E-08
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 102 176 2.0E-08
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 97 174 2.0E-08
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 98 174 3.0E-08
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 102 183 3.0E-08
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 99 181 3.0E-08
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 102 176 3.0E-08
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 104 176 5.0E-08
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 93 174 6.0E-08
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 93 174 7.0E-08
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 102 176 8.0E-08
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 104 176 9.0E-08
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 104 176 1.0E-07
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 93 174 1.0E-07
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 48 184 2.0E-07
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 79 184 6.0E-07
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 104 183 6.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 79 176 6.0E-07
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 99 183 7.0E-07
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 101 176 8.0E-07
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 79 184 9.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 99 184 1.0E-06
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 99 183 6.0E-06
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 104 175 6.0E-06
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 81 183 6.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 87 183 7.0E-06
sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 90 181 7.0E-06
sp|Q9SRS9|CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana GN=CHIP PE=1 SV=1 103 167 7.0E-06
sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=1 SV=1 84 184 9.0E-06
sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 96 181 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5646
MHSSKQRLALAFCHFLTTSTTDGTLTADDKDSVDVAINCIAESFKVDPSDRKAVDAAVGSQSLLQIYSVYEKLKS
GGASSSSSASNPAAGRDAAEPSDEQKKQAEALKSKGNAAMANKDYGAAIDLYTQALNLHPANAIFLSNRAAAHSA
AKDHASARIDAEAAVAIDATYTKAWASSTRATAAPTP*
Coding >Hirsu2|5646
ATGCACTCGTCCAAGCAGCGGCTCGCGCTCGCCTTCTGCCACTTCCTGACGACGTCCACCACGGACGGCACGCTG
ACGGCCGACGACAAGGACTCGGTCGACGTGGCCATCAACTGCATCGCCGAGTCGTTCAAGGTGGACCCGTCGGAC
CGCAAGGCCGTCGACGCCGCCGTCGGCTCCCAGTCGCTGCTGCAGATCTACTCCGTCTACGAGAAGCTCAAGTCC
GGCGGCGCCTCATCGTCGTCGTCGGCCTCGAATCCCGCCGCCGGGCGTGATGCGGCCGAGCCGTCGGACGAGCAG
AAGAAGCAGGCCGAGGCGCTCAAGAGCAAGGGCAACGCCGCCATGGCCAACAAGGACTACGGCGCCGCCATCGAC
CTCTACACGCAGGCGCTGAACCTGCACCCCGCCAACGCCATCTTCCTCTCGAACCGGGCGGCGGCGCACTCGGCC
GCCAAGGACCACGCCTCGGCGCGCATCGATGCCGAGGCGGCCGTCGCCATCGACGCCACCTACACCAAGGCCTGG
GCATCGAGCACGAGGGCAACGGCGGCTCCGACGCCATGA
Transcript >Hirsu2|5646
ATGCACTCGTCCAAGCAGCGGCTCGCGCTCGCCTTCTGCCACTTCCTGACGACGTCCACCACGGACGGCACGCTG
ACGGCCGACGACAAGGACTCGGTCGACGTGGCCATCAACTGCATCGCCGAGTCGTTCAAGGTGGACCCGTCGGAC
CGCAAGGCCGTCGACGCCGCCGTCGGCTCCCAGTCGCTGCTGCAGATCTACTCCGTCTACGAGAAGCTCAAGTCC
GGCGGCGCCTCATCGTCGTCGTCGGCCTCGAATCCCGCCGCCGGGCGTGATGCGGCCGAGCCGTCGGACGAGCAG
AAGAAGCAGGCCGAGGCGCTCAAGAGCAAGGGCAACGCCGCCATGGCCAACAAGGACTACGGCGCCGCCATCGAC
CTCTACACGCAGGCGCTGAACCTGCACCCCGCCAACGCCATCTTCCTCTCGAACCGGGCGGCGGCGCACTCGGCC
GCCAAGGACCACGCCTCGGCGCGCATCGATGCCGAGGCGGCCGTCGCCATCGACGCCACCTACACCAAGGCCTGG
GCATCGAGCACGAGGGCAACGGCGGCTCCGACGCCATGA
Gene >Hirsu2|5646
ATGGTTCGTCCGCTCAAGCTCTCTTCTCCTCCCCCCAACCCCCCCTCCGGGTCCTCGTGCTGGACCTTGCATGTG
CCGCCTCGGCTGACGAATGTCGTTTTCATTTCCTGTGCGCCCCAGGCCTCCCCACAAGCGCCGCCGTCGCAGCAC
TCGTCCAAGCAGCGGCTCGCGCTCGCCTTCTGCCACTTCCTGACGACGTCCACCACGGACGGCACGCTGACGGCC
GACGACAAGGACTCGGTCGACGTGGCCATCAACTGCATCGCCGAGTCGTTCAAGGTGGACCCGTCGGACCGCAAG
GCCGTCGACGCCGCCGTCGGCTCCCAGTCGCTGCTGCAGATCTACTCCGTCTACGAGAAGCTCAAGTCCGGCGGC
GCCTCATCGTCGTCGTCGGCCTCGAATCCCGCCGCCGGGCGTGATGCGGCCGAGCCGTCGGACGAGCAGAAGAAG
CAGGCCGAGGCGCTCAAGAGCAAGGGCAACGCCGCCATGGCCAACAAGGACTACGGCGCCGCCATCGACCTCTAC
ACGCAGGCGCTGAACCTGCACCCCGCCAACGCCATCTTCCTCTCGAACCGGGCGGCGGCGCACTCGGCCGCCAAG
GACCACGCCTCGGCGCGCATCGATGCCGAGGCGGCCGTCGCCATCGACGCCACCTACACCAAGGCCTGGTCCCGG
CTCGGGCTGGCGCGCTTCGCCCTCGGCGACGCCAAGGGCGCCATGGACGCCTACGCCCAGGGCATCGAGCACGAG
GGCAACGGCGGCTCCGACGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail