Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5643
Gene name
LocationContig_2832:106..1829
Strand+
Gene length (bp)1723
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 4.8E-29 243 516
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.7E-09 26 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 13 547 7.0E-174
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 13 547 2.0E-171
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 13 543 3.0E-170
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 9 545 1.0E-165
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 13 548 4.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 13 547 7.0E-174
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 13 547 2.0E-171
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 13 543 3.0E-170
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 9 545 1.0E-165
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 13 548 4.0E-159
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 199 537 3.0E-64
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 188 537 9.0E-63
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 193 547 3.0E-58
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 199 542 3.0E-58
sp|Q23221|FAT3_CAEEL Delta(6)-fatty-acid desaturase fat-3 OS=Caenorhabditis elegans GN=fat-3 PE=2 SV=2 160 535 1.0E-31
sp|G5EG11|FAT4_CAEEL Delta(5) fatty acid desaturase fat-4 OS=Caenorhabditis elegans GN=fat-4 PE=2 SV=1 150 542 4.0E-26
sp|Q9SWQ9|SLD1_EUGGR Delta(8)-fatty-acid desaturase OS=Euglena gracilis GN=efd1 PE=1 SV=1 185 514 4.0E-24
sp|Q4G2T3|DESAT_THAPS Sphingolipid 10-desaturase OS=Thalassiosira pseudonana GN=desA PE=1 SV=2 166 538 7.0E-16
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 185 521 1.0E-15
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 185 521 3.0E-15
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 185 521 5.0E-15
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 185 535 3.0E-14
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 185 532 4.0E-14
sp|Q920R3|FADS1_RAT Fatty acid desaturase 1 OS=Rattus norvegicus GN=Fads1 PE=2 SV=1 185 521 9.0E-14
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 185 521 3.0E-13
sp|A4KDP0|D5FAD_REBSA Acyl-lipid (8-3)-desaturase OS=Rebecca salina GN=D5Des PE=1 SV=1 192 534 4.0E-13
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 185 535 4.0E-13
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 185 514 6.0E-13
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 185 514 7.0E-13
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 185 532 1.0E-12
sp|Q9Y5Q0|FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 PE=2 SV=1 185 532 1.0E-12
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 185 532 2.0E-11
sp|A4KDP1|D8FAD_REBSA Acyl-lipid 8-desaturase OS=Rebecca salina GN=D8Des PE=2 SV=1 245 514 4.0E-11
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 185 514 3.0E-10
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 185 514 3.0E-10
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 185 514 7.0E-10
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 243 514 4.0E-08
sp|Q8S3C1|D5FAD_THRSP Acyl-lipid (8-3)-desaturase OS=Thraustochytrium sp. GN=Fad5 PE=1 SV=1 227 514 1.0E-07
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 30 86 4.0E-07
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 30 86 8.0E-07
sp|A0PJ29|D4FAD_REBSA Acyl-lipid (7-3)-desaturase OS=Rebecca salina GN=D4Des PE=1 SV=1 261 517 2.0E-06
sp|Q6VPV2|D4FAD_DIALT Acyl-lipid (7-3)-desaturase OS=Diacronema lutheri GN=Plesd1 PE=1 SV=1 247 514 3.0E-06
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 30 85 3.0E-06
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 30 86 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 235 257 22
2 272 294 22
3 354 376 22
4 391 410 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5643
MTAISRDPRSYPVMTRDEVEALIGCGHKIVIFQNYILKVDPWLPYHPGGDKAILHMVGRDATAEIEAVHSEEARN
QMLRYRIGEFDGLWKNFRPPLQGGTFRSLLDIRQNTPASDTPGNINVARGHMDSNLSSAISPLAPCGVSDRTVER
RACQSSQPTHGVMDEISYLDTITREHINIDLHKYPPPDPETQARIFVKYRELHRRVHDEGLYQCDAMAYAIDGCR
YVTLFSLMLLCLRFNQFAVGGIFLGFLWHQLVFAAHDAGHMGITHQYSLDTIIGILIADFIGGLSMGWWKRNHNV
HHIVTNAPEHDPDIEHMPLFAVSHRFLGSLRSTYYDRVMKYDVIAKFLLRFQSWTYYPLLALGRFNLYLLSWDYL
LANRGPRKGPGAWHRWLEIVGQLFFWTWFGYGILYKMIPDGWSRFGFIMTSHIASSPLHVQIVLSHFAMSTADLG
PHESFPQKMLRTTMDIDCPPWLDFVHGGLQFQVVHHLFPRLPRHNLRKAQKLVQEFCNDVGIPYALYGFADGNKQ
VVGRLTEVARQGAILAKCRKNIH*
Coding >Hirsu2|5643
ATGACGGCAATATCTCGTGATCCACGATCATACCCCGTCATGACGCGTGACGAGGTGGAAGCACTGATAGGATGC
GGTCATAAGATCGTTATATTTCAAAATTACATTCTCAAGGTCGATCCGTGGCTCCCGTACCATCCGGGTGGTGAT
AAGGCCATCTTACACATGGTTGGCAGAGATGCTACCGCCGAAATTGAAGCTGTTCATTCTGAAGAGGCGAGGAAT
CAGATGCTGCGATATCGGATTGGGGAATTTGATGGGCTGTGGAAGAACTTCAGGCCTCCACTTCAGGGGGGCACC
TTCCGCTCACTGCTAGACATAAGACAAAATACGCCCGCTTCAGATACGCCCGGCAACATCAACGTTGCAAGGGGT
CACATGGATTCAAATTTATCGAGCGCAATATCGCCCTTAGCCCCATGTGGCGTTAGCGATCGAACGGTGGAACGC
CGTGCCTGTCAGTCTTCACAGCCGACTCACGGCGTGATGGACGAAATATCTTATCTGGATACTATCACTCGCGAA
CATATCAATATCGATCTACATAAATATCCGCCGCCCGATCCGGAGACCCAGGCACGCATATTTGTCAAGTATCGA
GAGCTGCATCGAAGAGTTCACGACGAGGGCTTGTATCAGTGTGACGCAATGGCTTACGCCATCGACGGCTGTCGA
TACGTTACTCTCTTTTCATTGATGCTTCTCTGCCTGCGTTTCAATCAATTTGCCGTCGGAGGCATCTTCCTTGGC
TTTCTCTGGCATCAGCTTGTCTTCGCCGCCCATGATGCCGGGCATATGGGTATCACCCATCAATATAGCCTTGAC
ACGATCATCGGCATTCTTATCGCGGACTTCATTGGTGGCCTCTCAATGGGCTGGTGGAAAAGGAACCACAACGTT
CACCACATCGTGACTAATGCCCCCGAACATGATCCAGATATCGAACACATGCCACTCTTCGCTGTGTCGCATCGT
TTTTTGGGAAGCCTACGATCTACATACTACGACCGCGTCATGAAGTACGATGTAATCGCGAAGTTTCTACTTCGA
TTTCAGTCTTGGACTTACTATCCGCTACTGGCACTCGGGCGTTTTAACCTCTACTTGCTCTCATGGGACTATCTT
CTGGCGAACAGGGGCCCCAGAAAGGGCCCGGGCGCCTGGCACCGGTGGTTAGAGATAGTAGGACAACTCTTCTTC
TGGACTTGGTTCGGCTACGGTATTCTTTACAAAATGATACCAGACGGCTGGTCCCGATTTGGATTCATCATGACG
AGCCACATCGCGTCATCACCTCTCCATGTACAGATTGTCCTTTCCCACTTCGCAATGAGCACGGCGGATCTTGGT
CCGCACGAGTCTTTTCCCCAGAAGATGTTACGTACCACCATGGATATTGATTGCCCGCCGTGGCTCGATTTCGTT
CATGGAGGACTTCAATTCCAGGTTGTTCATCACCTTTTCCCGCGCTTGCCCAGACATAATCTTCGCAAGGCGCAG
AAGCTGGTCCAAGAGTTTTGTAATGATGTGGGCATACCGTATGCGCTATATGGTTTTGCAGACGGTAATAAGCAA
GTCGTTGGTCGCCTTACCGAGGTTGCAAGACAAGGTGCTATTTTAGCAAAGTGCCGAAAAAATATTCATTAA
Transcript >Hirsu2|5643
ATGACGGCAATATCTCGTGATCCACGATCATACCCCGTCATGACGCGTGACGAGGTGGAAGCACTGATAGGATGC
GGTCATAAGATCGTTATATTTCAAAATTACATTCTCAAGGTCGATCCGTGGCTCCCGTACCATCCGGGTGGTGAT
AAGGCCATCTTACACATGGTTGGCAGAGATGCTACCGCCGAAATTGAAGCTGTTCATTCTGAAGAGGCGAGGAAT
CAGATGCTGCGATATCGGATTGGGGAATTTGATGGGCTGTGGAAGAACTTCAGGCCTCCACTTCAGGGGGGCACC
TTCCGCTCACTGCTAGACATAAGACAAAATACGCCCGCTTCAGATACGCCCGGCAACATCAACGTTGCAAGGGGT
CACATGGATTCAAATTTATCGAGCGCAATATCGCCCTTAGCCCCATGTGGCGTTAGCGATCGAACGGTGGAACGC
CGTGCCTGTCAGTCTTCACAGCCGACTCACGGCGTGATGGACGAAATATCTTATCTGGATACTATCACTCGCGAA
CATATCAATATCGATCTACATAAATATCCGCCGCCCGATCCGGAGACCCAGGCACGCATATTTGTCAAGTATCGA
GAGCTGCATCGAAGAGTTCACGACGAGGGCTTGTATCAGTGTGACGCAATGGCTTACGCCATCGACGGCTGTCGA
TACGTTACTCTCTTTTCATTGATGCTTCTCTGCCTGCGTTTCAATCAATTTGCCGTCGGAGGCATCTTCCTTGGC
TTTCTCTGGCATCAGCTTGTCTTCGCCGCCCATGATGCCGGGCATATGGGTATCACCCATCAATATAGCCTTGAC
ACGATCATCGGCATTCTTATCGCGGACTTCATTGGTGGCCTCTCAATGGGCTGGTGGAAAAGGAACCACAACGTT
CACCACATCGTGACTAATGCCCCCGAACATGATCCAGATATCGAACACATGCCACTCTTCGCTGTGTCGCATCGT
TTTTTGGGAAGCCTACGATCTACATACTACGACCGCGTCATGAAGTACGATGTAATCGCGAAGTTTCTACTTCGA
TTTCAGTCTTGGACTTACTATCCGCTACTGGCACTCGGGCGTTTTAACCTCTACTTGCTCTCATGGGACTATCTT
CTGGCGAACAGGGGCCCCAGAAAGGGCCCGGGCGCCTGGCACCGGTGGTTAGAGATAGTAGGACAACTCTTCTTC
TGGACTTGGTTCGGCTACGGTATTCTTTACAAAATGATACCAGACGGCTGGTCCCGATTTGGATTCATCATGACG
AGCCACATCGCGTCATCACCTCTCCATGTACAGATTGTCCTTTCCCACTTCGCAATGAGCACGGCGGATCTTGGT
CCGCACGAGTCTTTTCCCCAGAAGATGTTACGTACCACCATGGATATTGATTGCCCGCCGTGGCTCGATTTCGTT
CATGGAGGACTTCAATTCCAGGTTGTTCATCACCTTTTCCCGCGCTTGCCCAGACATAATCTTCGCAAGGCGCAG
AAGCTGGTCCAAGAGTTTTGTAATGATGTGGGCATACCGTATGCGCTATATGGTTTTGCAGACGGTAATAAGCAA
GTCGTTGGTCGCCTTACCGAGGTTGCAAGACAAGGTGCTATTTTAGCAAAGTGCCGAAAAAATATTCATTAA
Gene >Hirsu2|5643
ATGACGGCAATATCTCGTGATCCACGATCATACCCCGTCATGACGCGTGACGAGGTGGAAGCACTGATAGGATGC
GGTCATAAGATCGTTATATTTCAAAATTACATTCTCAAGGTCGATCCGTGGCTCCCGTACCATCCGGGTGGTGAT
AAGGCCATCTTACACATGGTTGGCAGAGATGCTACCGCCGAAATTGAAGCGTACACCCAGTCCTTCTGCACCCCT
CCTCTATTGTAGCACTCTGCAGGAGTCTATTTCTGACTTTCGTCTCTCTAGTGTTCATTCTGAAGAGGCGAGGAA
TCAGATGCTGCGATATCGGATTGGGGAATTTGATGGGCTGTGGAAGAACTTCAGGCCTCCACTTCAGGGGGGCAC
CTTCCGCTCACTGCTAGACATAAGACAAAATACGCCCGCTTCAGATACGCCCGGCAACATCAACGTTGCAAGGGG
TCACATGGATTCAAATTTATCGAGCGCAATATCGCCCTTAGCCCCATGTGGCGTTAGCGATCGAACGGTGGAACG
CCGTGCCTGTCAGTCTTCACAGCCGACTCACGGCGTGATGGACGAAATATCTTATCTGGATACTATCACTCGCGA
ACATATCAATATCGATCTACATAAATATCCGCCGCCCGATCCGGAGACCCAGGCACGCATATTTGTCAAGTATCG
AGAGCTGCATCGAAGAGTTCACGACGAGGGCTTGTATCAGTGTGACGCAATGGCTTACGCCATCGACGGCTGTCG
ATACGTTACTCTCTTTTCATTGATGCTTCTCTGCCTGCGTTTCAATCAATTTGCCGTCGGAGGCATCTTCCTTGG
CTTTCTCTGGCATCAGCTTGTCTTCGCCGCCCATGATGCCGGGCATATGGGTATCACCCATCAATATAGCCTTGA
CACGATCATCGGCATTCTTATCGCGGACTTCATTGGTGGCCTCTCAATGGGCTGGTGGAAAAGGAACCACAACGT
TCACCACATCGTGACTAATGCCCCCGAACATGATCCAGATATCGAACACATGCCACTCTTCGCTGTGTCGCATCG
TTTTTTGGGAAGCCTACGATCTACATACTACGACCGCGTCATGAAGTACGATGTAATCGCGAAGTTTCTACTTCG
ATTTCAGTCTTGGACTTACTATCCGCTACTGGCACTCGGGCGTTTTAACCTCTACTTGCTCTCATGGGACTATCT
TCTGGCGAACAGGGGCCCCAGAAAGGGCCCGGGCGCCTGGCACCGGTGGTTAGAGATAGTAGGACAACTCTTCTT
CTGGACTTGGTTCGGCTACGGTATTCTTTACAAAATGATACCAGACGGCTGGTCCCGATTTGGATTCATCATGAC
GAGCCACATCGCGTCATCACCTCTCCATGTACAGATTGTCCTTTCCCACTTCGCAATGAGCACGGCGGATCTTGG
TCCGCACGAGTCTTTTCCCCAGAAGATGTTACGTACCACCATGGATATTGATTGCCCGCCGTGGCTCGATTTCGT
TCATGGAGGACTTCAATTCCAGGTTGTTCATCACCTTTTCCCGCGCTTGCCCAGACATAATCTTCGCAAGGCGCA
GAAGCTGGTCCAAGAGTTTTGTAATGATGTGGGCATACCGTATGCGCTATATGGTTTTGCAGACGGTAATAAGCA
AGTCGTTGGTCGCCTTACCGAGGTTGCAAGACAAGGTGCTATTTTAGCAAAGTGCCGAAAAAATATTCATTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail